DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pof and Celf2

DIOPT Version :9

Sequence 1:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_038951514.1 Gene:Celf2 / 29428 RGDID:68347 Length:546 Species:Rattus norvegicus


Alignment Length:235 Identity:45/235 - (19%)
Similarity:83/235 - (35%) Gaps:60/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PDTAKLSRRELAKMRREHTLRALALERELTNKPGQTPASEVLLVRFPDPEITAPMLAGLSKDIRD 157
            ||..|:...::.:...|..|      :||....|......||..|..:|    |...|.      
  Rat    65 PDAIKMFVGQIPRSWSEKEL------KELFEPYGAVYQINVLRDRSQNP----PQSKGC------ 113

  Fly   158 VVLPISVAPRYCLVHL---KAGADVEATICDINRVRFGTG-HLRAELKPFSDEEQAEFIDPCSLY 218
                       |.|..   ||..:.:..:.:|..:   .| |...::|| :|.|::..::...|:
  Rat   114 -----------CFVTFYTRKAALEAQNALHNIKTL---PGMHHPIQMKP-ADSEKSNAVEDRKLF 163

  Fly   219 VGNIPFNMTTSAIKAYFANAMRVDIGVLKREKRAR--------YAFVRYASPDQTMEAFKELVDS 275
            :|.:......:.|:..|:     ..|.::..:..|        .|||.:::......|.|.:..|
  Rat   164 IGMVSKKCNENDIRVMFS-----PFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQS 223

  Fly   276 PLN---SRTLTVRY---------RRLRKRAGMPMVQCATS 303
            ...   |..:.|::         |||:::....|.|..|:
  Rat   224 QTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PofNP_001246498.1 RRM <201..>292 CDD:223796 21/110 (19%)
RRM_SF 217..285 CDD:240668 13/78 (17%)
Celf2XP_038951514.1 RRM1_CELF1_2_Bruno 67..150 CDD:410040 21/113 (19%)
RRM2_CELF1_2 159..239 CDD:410042 14/84 (17%)
RRM3_CELF1_2 454..545 CDD:241082
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.