DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pof and bru2

DIOPT Version :9

Sequence 1:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001036356.1 Gene:bru2 / 250811 FlyBaseID:FBgn0262475 Length:893 Species:Drosophila melanogaster


Alignment Length:257 Identity:53/257 - (20%)
Similarity:92/257 - (35%) Gaps:59/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 HLRAELKPFSDEEQAEFIDPCSLYVGNIPFNMTTSAIKAYFANAMRVDIGVLKREKRAR---YAF 256
            |...::||...|.:.|    ..|:||.:....|.:.::..|.....::...:.|::..:   .||
  Fly   366 HHPIQMKPADSENRNE----RKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQAGQSKGCAF 426

  Fly   257 VRYASPDQTMEAFKELVDSPLN---SRTLTVRYRRLRKRAGMPMVQCATSFQALQSPNG------ 312
            |.:|:....:.|.|.|..|...   |..|.|::...:|......:|...:|..:.:|:|      
  Fly   427 VTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQIHAFCGINTPSGATAGAA 491

  Fly   313 -DDDNTDCKVISPPPLESIIISDSDNCSDSSGNGKEDGKRKKKINEQEREIEKLKRQMAEYGAII 376
             ...|....:|:.||              |:|                    :....||...|.:
  Fly   492 TPTINAATALIAAPP--------------SAG--------------------RTNPSMAAALAAV 522

  Fly   377 KSLQFRQN--SLEDTFIP-DLTPKVEPSVNPTGCLLGSNAVHLMRDIKKECDYLGIPDPVPA 435
            ..:|...:  :...|.:| :.|..:..|:.|.  ||.:||.|  :.......||| .||..|
  Fly   523 PQVQQAGSAATAPTTLVPLNSTTALSASLTPN--LLATNAAH--QGAAAAAAYLG-ADPAAA 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PofNP_001246498.1 RRM <201..>292 CDD:223796 21/96 (22%)
RRM_SF 217..285 CDD:240668 16/73 (22%)
bru2NP_001036356.1 RRM1_CELF1_2_Bruno 294..375 CDD:241075 3/8 (38%)
RRM2_Bruno_like 381..461 CDD:241080 18/83 (22%)
RRM_SF 801..892 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.