DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pof and Celf2

DIOPT Version :9

Sequence 1:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_030103179.1 Gene:Celf2 / 14007 MGIID:1338822 Length:536 Species:Mus musculus


Alignment Length:267 Identity:51/267 - (19%)
Similarity:95/267 - (35%) Gaps:72/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KTSVDLDN-DAELEKPTSDK-----------KPDTAKLSRRELAKMRREHTLRALALERELTNKP 125
            |::|.:.| :..|...|::|           .||..|:...::.:...|..|      :||....
Mouse    23 KSAVTMRNEELLLSNGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKEL------KELFEPY 81

  Fly   126 GQTPASEVLLVRFPDPEITAPMLAGLSKDIRDVVLPISVAPRYCLVHL---KAGADVEATICDIN 187
            |......||..|..:|    |...|.                 |.|..   ||..:.:..:.:|.
Mouse    82 GAVYQINVLRDRSQNP----PQSKGC-----------------CFVTFYTRKAALEAQNALHNIK 125

  Fly   188 RVRFGTG-HLRAELKPFSDEEQAEFIDPCSLYVGNIPFNMTTSAIKAYFANAMRVDIGVLKREKR 251
            .:   .| |...::|| :|.|::..::...|::|.:......:.|:..|:     ..|.::..:.
Mouse   126 TL---PGMHHPIQMKP-ADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFS-----PFGQIEECRI 181

  Fly   252 AR--------YAFVRYASPDQTMEAFKELVDSPLN---SRTLTVRY---------RRLRKRAGMP 296
            .|        .|||.:::......|.|.:..|...   |..:.|::         |||:::....
Mouse   182 LRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQ 246

  Fly   297 MVQCATS 303
            |.|..|:
Mouse   247 MQQLNTA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PofNP_001246498.1 RRM <201..>292 CDD:223796 21/110 (19%)
RRM_SF 217..285 CDD:240668 13/78 (17%)
Celf2XP_030103179.1 RRM1_CELF1_2_Bruno 57..140 CDD:241075 21/113 (19%)
RRM2_CELF1_2 149..229 CDD:241078 14/84 (17%)
RRM3_CELF1_2 444..535 CDD:241082
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.