DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pof and Celf1

DIOPT Version :9

Sequence 1:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_017170784.1 Gene:Celf1 / 13046 MGIID:1342295 Length:514 Species:Mus musculus


Alignment Length:241 Identity:44/241 - (18%)
Similarity:83/241 - (34%) Gaps:87/241 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 HLRAELKPFSDEEQAEFIDPCSLYVGNIPFNMTTSAIKAYFANAMRVDIGVLKREKRARYAFVRY 259
            |...::|| :|.|:...::...|::|.|....|.:.|:..|::..:::...:.|           
Mouse   116 HHPIQMKP-ADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILR----------- 168

  Fly   260 ASPDQTME--AFKELVDSPLNSRTLTVRYRRLRKRAGMPMVQCATSFQALQSPNGDDDNTDCKVI 322
             .||....  ||            :|...|.:.:.|...|.| |.:.:...||            
Mouse   169 -GPDGLSRGCAF------------VTFTTRTMAQTAIKAMHQ-AQTMEGCSSP------------ 207

  Fly   323 SPPPLESIIISDSDNCSDSSGNGKEDGKRKKKINEQEREIEKLKRQMAEYGA------------- 374
                   :::..:|.               :|..||:|..::|::||.:..|             
Mouse   208 -------MVVKFADT---------------QKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTL 250

  Fly   375 ----IIKSLQFRQNSLEDTFIPDLTPKVEPSVNPTGCLLGSNAVHL 416
                :...||..|.:.....:..|:     |::|.|   |.||:.|
Mouse   251 GPQYLALYLQLLQQTASSGNLNTLS-----SLHPMG---GLNAMQL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PofNP_001246498.1 RRM <201..>292 CDD:223796 17/92 (18%)
RRM_SF 217..285 CDD:240668 12/69 (17%)
Celf1XP_017170784.1 RRM1_CELF1_2_Bruno 42..125 CDD:410040 3/9 (33%)
RRM2_CELF1_2 134..214 CDD:410042 19/123 (15%)
RRM3_CELF1_2 422..513 CDD:241082
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.