DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pof and CELF3

DIOPT Version :9

Sequence 1:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_009116.3 Gene:CELF3 / 11189 HGNCID:11967 Length:465 Species:Homo sapiens


Alignment Length:323 Identity:57/323 - (17%)
Similarity:100/323 - (30%) Gaps:119/323 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 DPCSLYVGNIPFNMTTSAIKAYFANAMRV-DIGVLKREKRARY---AFVRYASPDQTMEAFKELV 273
            |...|:||.||.::....:|..|....|: ::.|:|.:....:   ||:.|.:.|..::|...|.
Human     5 DAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALH 69

  Fly   274 DS---PLNSRTLTVRYRRLRKR-------AGM------------------PMVQCATSFQALQSP 310
            :.   |..:|.:.|:......|       .||                  .:.:|.    .|:.|
Human    70 EQKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECT----VLRGP 130

  Fly   311 NGDDDNTDCKVIS--------------------PPPLESIIISDSDNCSDSSGNGKEDG-KRKKK 354
            :|  .:..|..:.                    |....|:::..:|       ..||.| :|.::
Human   131 DG--TSKGCAFVKFQTHAEAQAAINTLHSSRTLPGASSSLVVKFAD-------TEKERGLRRMQQ 186

  Fly   355 INEQEREIEKLKRQMAEYGAIIKSLQFRQNSLEDTFIPDLTPKVE---------PSVNPTGCL-- 408
            :..|......:..|...|.|..::|..:|.:|.......|:|...         .::|..|.:  
Human   187 VATQLGMFSPIALQFGAYSAYTQALMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIAT 251

  Fly   409 -------------------------LGSNAVHLMRDIKKECDYLGIPDPVPATKPTTQAQDDS 446
                                     ||.|..                .||| |:||.|...|:
Human   252 PITPSSGTSTPPAIAATPVSAIPAALGVNGY----------------SPVP-TQPTGQPAPDA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PofNP_001246498.1 RRM <201..>292 CDD:223796 20/85 (24%)
RRM_SF 217..285 CDD:240668 18/74 (24%)
CELF3NP_009116.3 RRM1_CELF3_4_5_6 2..88 CDD:410041 20/82 (24%)
RRM2_CELF3_4_5_6 94..174 CDD:410043 9/85 (11%)
PRK12323 <214..>351 CDD:237057 17/101 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..379
RRM3_CELF3_4_5_6 376..454 CDD:241083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.