DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pof and CELF2

DIOPT Version :9

Sequence 1:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_024303540.1 Gene:CELF2 / 10659 HGNCID:2550 Length:549 Species:Homo sapiens


Alignment Length:263 Identity:53/263 - (20%)
Similarity:93/263 - (35%) Gaps:64/263 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AGSQLLPWKTSVDLDNDAELEKPTSDKKPDTAKLSRRELAKMRREHTLRALALERELTNKPGQTP 129
            |||  ||...:.:..|.|.......|  ||..|:...::.:...|..|      :||....|...
Human    44 AGS--LPSNGTANKMNGALDHSDQPD--PDAIKMFVGQIPRSWSEKEL------KELFEPYGAVY 98

  Fly   130 ASEVLLVRFPDPEITAPMLAGLSKDIRDVVLPISVAPRYCLVHL---KAGADVEATICDINRVRF 191
            ...||..|..:|    |...|.                 |.|..   ||..:.:..:.:|..:  
Human    99 QINVLRDRSQNP----PQSKGC-----------------CFVTFYTRKAALEAQNALHNIKTL-- 140

  Fly   192 GTG-HLRAELKPFSDEEQAEFIDPCSLYVGNIPFNMTTSAIKAYFANAMRVDIGVLKREKRAR-- 253
             .| |...::|| :|.|::..::...|::|.:......:.|:..|:     ..|.::..:..|  
Human   141 -PGMHHPIQMKP-ADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFS-----PFGQIEECRILRGP 198

  Fly   254 ------YAFVRYASPDQTMEAFKELVDSPLN---SRTLTVRY---------RRLRKRAGMPMVQC 300
                  .|||.:::......|.|.:..|...   |..:.|::         |||:::....|.|.
Human   199 DGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQL 263

  Fly   301 ATS 303
            .|:
Human   264 NTA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PofNP_001246498.1 RRM <201..>292 CDD:223796 21/110 (19%)
RRM_SF 217..285 CDD:240668 13/78 (17%)
CELF2XP_024303540.1 RRM1_CELF1_2_Bruno 70..153 CDD:241075 21/113 (19%)
RRM2_CELF1_2 162..242 CDD:241078 14/84 (17%)
RRM3_CELF1_2 457..548 CDD:241082
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146316
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.