DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-19 and AT3G06310

DIOPT Version :9

Sequence 1:NP_001163296.1 Gene:ND-19 / 37946 FlyBaseID:FBgn0035046 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001189824.1 Gene:AT3G06310 / 819805 AraportID:AT3G06310 Length:108 Species:Arabidopsis thaliana


Alignment Length:90 Identity:31/90 - (34%)
Similarity:46/90 - (51%) Gaps:2/90 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSAALRAGAFHLGKQCEQANNEFMLCRQELDDPRACLAEGKAVTSCALDFFRKVKKTCHEEFTQY 87
            :||.|.|.|.|:|.:|...|..|:.|::...:|..||.:|:.||.|.|...:.:.:.|.:|...|
plant    16 TSAVLTASAKHIGIRCMPENMAFLKCKKNDPNPEKCLEKGRDVTRCVLGLLKDLHQRCPKEMDAY 80

  Fly    88 ATCLDKSSGTMAFSHCRKTQGVFDK 112
            ..|:  ...|..|..|||.|..|:|
plant    81 VGCM--YYYTNEFELCRKEQEAFEK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-19NP_001163296.1 CHCH 80..116 CDD:399611 12/33 (36%)
AT3G06310NP_001189824.1 CHCH 73..103 CDD:399611 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4744
eggNOG 1 0.900 - - E1_KOG3458
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2533
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1526152at2759
OrthoFinder 1 1.000 - - FOG0005263
OrthoInspector 1 1.000 - - otm2887
orthoMCL 1 0.900 - - OOG6_103954
Panther 1 1.100 - - O PTHR13344
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.