DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-19 and Ndufa8

DIOPT Version :9

Sequence 1:NP_001163296.1 Gene:ND-19 / 37946 FlyBaseID:FBgn0035046 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_080979.1 Gene:Ndufa8 / 68375 MGIID:1915625 Length:172 Species:Mus musculus


Alignment Length:164 Identity:75/164 - (45%)
Similarity:99/164 - (60%) Gaps:4/164 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPEESELNVQELNLSSAALRAGAFHLGKQCEQANNEFMLCRQELDDPRACLAEGKAVTSCALDFF 73
            ||...||.|:|:.:|||.|:|.|.|.|.||::.|.||||||.|..|||.||.|||.|..|||:||
Mouse     7 LPTLEELKVEEVKVSSAVLKAAAHHYGAQCDKTNKEFMLCRWEEKDPRRCLKEGKLVNGCALNFF 71

  Fly    74 RKVKKTCHEEFTQYATCLDKSSGTMAFSHCRKTQGVFDKCIKDNFDWDRPSYGYFSRAKVIQSAR 138
            |::|..|.|.||:|.||||.|: ...|.|||:.|..||:|:.|...|.||..|..|:...:::.|
Mouse    72 RQIKSHCAEPFTEYWTCLDYSN-MQLFRHCRQQQAKFDQCVLDKLGWVRPDLGQLSKVTKVKTDR 135

  Fly   139 EAPKKE-EKVSYPDATPGLPEDYPKPPAKYGSRF 171
            ..|:.. ...:.|:..|.:..|.  .|||:|:||
Mouse   136 PLPENPYHSRARPEPNPVIEGDL--KPAKHGTRF 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-19NP_001163296.1 CHCH 80..116 CDD:399611 18/35 (51%)
Ndufa8NP_080979.1 Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 36..46 5/9 (56%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 56..66 6/9 (67%)
CHCH 78..111 CDD:399611 17/33 (52%)
Cx9C motif 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 78..88 5/9 (56%)
Cx9C motif 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 100..110 5/9 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850734
Domainoid 1 1.000 87 1.000 Domainoid score I8016
eggNOG 1 0.900 - - E1_KOG3458
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40932
Inparanoid 1 1.050 148 1.000 Inparanoid score I4384
Isobase 1 0.950 - 0 Normalized mean entropy S4539
OMA 1 1.010 - - QHG45925
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005263
OrthoInspector 1 1.000 - - oto95375
orthoMCL 1 0.900 - - OOG6_103954
Panther 1 1.100 - - LDO PTHR13344
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4238
SonicParanoid 1 1.000 - - X4877
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.