DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-19 and Y54F10AM.5

DIOPT Version :9

Sequence 1:NP_001163296.1 Gene:ND-19 / 37946 FlyBaseID:FBgn0035046 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_497574.2 Gene:Y54F10AM.5 / 175371 WormBaseID:WBGene00021849 Length:183 Species:Caenorhabditis elegans


Alignment Length:164 Identity:64/164 - (39%)
Similarity:95/164 - (57%) Gaps:4/164 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVITNNTTLPEESELNV-QELNLSSAALRAGAFHLGKQCEQANNEFMLCRQELDDPRACLAEGKA 64
            |.||.:|..|.:.||.| ||:.||:..|::.|.::.|.||:..|||||.|:|.:||||.|.||.|
 Worm     1 MSITKDTHFPSDEELTVPQEITLSTPWLKSIAPYMAKHCEKEANEFMLRRKEAEDPRAVLKEGAA 65

  Fly    65 VTSCALDFFRKVKKTCHEEFTQYATCLDKSSGTMAFSHCRKTQGVFDKCIKDNFDWDRPSYGYFS 129
            :|:|.::|.:.:|::|..:..:.|.|:|:||..:..|.|...|...|.|::.|.:..||..||||
 Worm    66 LTACGVNFLQSLKRSCLPQTQKLAECVDQSSAKLYMSKCHDDQKELDACVEANLNLTRPKLGYFS 130

  Fly   130 RAKVIQSAREAPK---KEEKVSYPDATPGLPEDY 160
            :..|..||..||:   ::.|.........||.||
 Worm   131 KLHVYDSATAAPEVKLRDYKAEAAKVLNELPADY 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-19NP_001163296.1 CHCH 80..116 CDD:399611 11/35 (31%)
Y54F10AM.5NP_497574.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3458
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40932
Inparanoid 1 1.050 119 1.000 Inparanoid score I3352
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45925
OrthoDB 1 1.010 - - D1526152at2759
OrthoFinder 1 1.000 - - FOG0005263
OrthoInspector 1 1.000 - - oto19046
orthoMCL 1 0.900 - - OOG6_103954
Panther 1 1.100 - - LDO PTHR13344
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4238
SonicParanoid 1 1.000 - - X4877
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.