DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-19 and ndufa8

DIOPT Version :9

Sequence 1:NP_001163296.1 Gene:ND-19 / 37946 FlyBaseID:FBgn0035046 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001096491.1 Gene:ndufa8 / 100125113 XenbaseID:XB-GENE-979564 Length:172 Species:Xenopus tropicalis


Alignment Length:168 Identity:78/168 - (46%)
Similarity:101/168 - (60%) Gaps:7/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPEESELNVQELNLSSAALRAGAFHLGKQCEQANNEFMLCRQELDDPRACLAEGKAVTSCALDFF 73
            ||...||:||||::|||.|:|.|.|.|.||::.|.||||||.|..|||.||.||:.|.:||||||
 Frog     7 LPSAEELSVQELDVSSAVLKAAAHHYGSQCDKPNKEFMLCRWEEKDPRKCLVEGRKVNACALDFF 71

  Fly    74 RKVKKTCHEEFTQYATCLDKSSGTMAFSHCRKTQGVFDKCIKDNFDWDRPSYGYFSRAKVIQSAR 138
            ||:|..|.|.||:|.||:|.|: .:....|||.|..||.|:.|...|.||..|..|:...:::.|
 Frog    72 RKIKTHCAEPFTEYWTCIDYSN-LLELRRCRKQQAAFDNCVLDKLGWTRPELGDLSKVTKVKTDR 135

  Fly   139 EAPKKEEKV--SYPDATPGLPEDYPKPPAKYGSR-FHW 173
            ..|   :.:  |.|...|..|.:....|:||||: |.|
 Frog   136 ALP---DNIYHSRPRPEPNPPIEGELKPSKYGSKMFFW 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-19NP_001163296.1 CHCH 80..116 CDD:399611 16/35 (46%)
ndufa8NP_001096491.1 CHCH 78..111 CDD:369061 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7388
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40932
Inparanoid 1 1.050 153 1.000 Inparanoid score I4236
OMA 1 1.010 - - QHG45925
OrthoDB 1 1.010 - - D1526152at2759
OrthoFinder 1 1.000 - - FOG0005263
OrthoInspector 1 1.000 - - oto105553
Panther 1 1.100 - - LDO PTHR13344
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4238
SonicParanoid 1 1.000 - - X4877
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.