DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30161 and CG15909

DIOPT Version :9

Sequence 1:NP_611953.2 Gene:CG30161 / 37945 FlyBaseID:FBgn0050161 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_610225.1 Gene:CG15909 / 35572 FlyBaseID:FBgn0033090 Length:352 Species:Drosophila melanogaster


Alignment Length:203 Identity:50/203 - (24%)
Similarity:87/203 - (42%) Gaps:57/203 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NSVDTIVKNLIDNWQSPLVYLKSRGYLPK---DAPEMDFQQLQGNLDPKLSLNDLVELNKDSKRE 88
            ::.:.:|:|||.||:||:||||.||:||:   ||..:           |.||:.|::..|.:||:
  Fly    36 HAYNEVVQNLIKNWESPVVYLKKRGFLPRNYEDASRI-----------KHSLDALMQRIKRAKRD 89

  Fly    89 AETKS-----QDNSIGQIDPRAVRSLQDPKDLELKKMFQTLFSSNDKTASEEIKSKLGVSWDMNA 148
             .||.     :...:.:..||..|..|    |....|..:|         |::|.   :......
  Fly    90 -HTKEVTFNVRPKEMAKAYPRNQRGFQ----LSTGTMLSSL---------EQLKV---IEGQATK 137

  Fly   149 LKTSAR--------LGAKKYLEKFNNKRNKG---------MSLLPIESSDGTLTNEASLNFSSLI 196
            .||:|:        |..|:.||:.......|         :.:.||:...|    :::.::..::
  Fly   138 AKTTAKSSEQEQELLAMKRRLEELQQVAGTGQDQPGYRRQIKVNPIDKDPG----KSAQSYDEIL 198

  Fly   197 PHALEKKS 204
            ...:||.|
  Fly   199 QRMIEKTS 206



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019937
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.