DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3663 and PNC1

DIOPT Version :9

Sequence 1:NP_611952.1 Gene:CG3663 / 37944 FlyBaseID:FBgn0035044 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_011478.3 Gene:PNC1 / 852846 SGDID:S000003005 Length:216 Species:Saccharomyces cerevisiae


Alignment Length:110 Identity:25/110 - (22%)
Similarity:39/110 - (35%) Gaps:17/110 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DKLTRAGKALDVPLIVTEHYPEKLGKTVAQLDVSHAKLVSGKTLFSMFTPEVKAVIKDIFNDKPE 103
            |..|:.|....|..:......:.:.:.:.|:...|.|:|....|...   |..:...||:|....
Yeast    82 DDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDR---EYYSAFHDIWNFHKT 143

  Fly   104 DVVLYGLESH-------------ICVEQTAIDLLEQNINVYIVAD 135
            |:..| ||.|             .||:.|||...|......::.|
Yeast   144 DMNKY-LEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3663NP_611952.1 YcaC_related 14..171 CDD:238494 25/110 (23%)
PNC1NP_011478.3 nicotinamidase 1..214 CDD:238493 25/110 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.