DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3663 and isoc1

DIOPT Version :9

Sequence 1:NP_611952.1 Gene:CG3663 / 37944 FlyBaseID:FBgn0035044 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_012821047.2 Gene:isoc1 / 780052 XenbaseID:XB-GENE-491284 Length:317 Species:Xenopus tropicalis


Alignment Length:179 Identity:80/179 - (44%)
Similarity:121/179 - (67%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HLNPKKTLFLLCDIQEKFRPAMPLFDNMIKNVDKLTRAGKALDVPLIVTEHYPEKLGKTVAQLDV 71
            :|.|..|:|..||:||:||||:..|.::|....:|.:..:.|.:|:|.||.||:.||.||.:||:
 Frog   128 NLTPASTVFFCCDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIATEQYPKGLGSTVQELDL 192

  Fly    72 SHAKLVSGKTLFSMFTPEVKAVIKDIFNDKPEDVVLYGLESHICVEQTAIDLLEQNINVYIVADC 136
            :..|||..||.|||..|||:|.:.:  ......|||:|:|:|:|::|||:||:.:.:.|:||||.
 Frog   193 TGVKLVLPKTKFSMVLPEVEAALAE--TPGVRSVVLFGVETHVCIQQTALDLIGRGVEVHIVADA 255

  Fly   137 CSSRLNQDRDLALDRLRQAGCVITTSESVIFDLVRDKNNPKFDVVRKLV 185
            .|||...||..||:||.:.|.:|||||:::..||.||::|||..::.|:
 Frog   256 TSSRSMMDRMFALERLARNGIIITTSEAILLQLVADKDHPKFKEIQNLI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3663NP_611952.1 YcaC_related 14..171 CDD:238494 70/156 (45%)
isoc1XP_012821047.2 YcaC_related 135..289 CDD:238494 69/155 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4744
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9361
Inparanoid 1 1.050 164 1.000 Inparanoid score I4075
OMA 1 1.010 - - QHG54144
OrthoDB 1 1.010 - - D1100720at2759
OrthoFinder 1 1.000 - - FOG0001690
OrthoInspector 1 1.000 - - mtm9400
Panther 1 1.100 - - LDO PTHR14119
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3803
SonicParanoid 1 1.000 - - X1084
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.