DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3663 and LOC684270

DIOPT Version :9

Sequence 1:NP_611952.1 Gene:CG3663 / 37944 FlyBaseID:FBgn0035044 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_003748808.1 Gene:LOC684270 / 684270 RGDID:1592677 Length:209 Species:Rattus norvegicus


Alignment Length:198 Identity:77/198 - (38%)
Similarity:124/198 - (62%) Gaps:9/198 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALRRCHL---NPKKTLFLLCDIQEKFRPAMPLFDNMIKNVDKLTRAGKALDVPLIVTEHYPEKL 62
            ||..|..|   .|:.::..|||:||||||::..|..::....::.:..:.||||:::||.||:.|
  Rat     1 MAAARASLGRIRPESSILFLCDMQEKFRPSIAYFPQIVSVAARMLKVARLLDVPILLTEQYPQGL 65

  Fly    63 GKTVAQLDVSHAKLVSGKTLFSMFTPEVKAVIKDI-FNDKPEDVVLYGLESHICVEQTAIDLLEQ 126
            |.||.:|.....|.|| ||.|||    |.::.|:: ...:.:.|:|.|:|:..|:..|.:|||::
  Rat    66 GPTVPELGAQGIKPVS-KTCFSM----VPSLQKELDRRSQLQSVLLCGIETQACILNTVLDLLDR 125

  Fly   127 NINVYIVADCCSSRLNQDRDLALDRLRQAGCVITTSESVIFDLVRDKNNPKFDVVRKLVNQPSVD 191
            .:.|::|.|.||||...||.:||.|:||:|..::||||:|..||||..:|:|..::|::.:|:.|
  Rat   126 GLQVHVVVDACSSRSQIDRLVALGRMRQSGAFLSTSESLILQLVRDAAHPQFKEIQKIIKEPAPD 190

  Fly   192 MEL 194
            ..|
  Rat   191 SGL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3663NP_611952.1 YcaC_related 14..171 CDD:238494 63/157 (40%)
LOC684270XP_003748808.1 YcaC_related 18..170 CDD:238494 63/156 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 140 1.000 Domainoid score I4629
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I4086
OMA 1 1.010 - - QHG54144
OrthoDB 1 1.010 - - D1100720at2759
OrthoFinder 1 1.000 - - FOG0001690
OrthoInspector 1 1.000 - - mtm8973
orthoMCL 1 0.900 - - OOG6_101675
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1084
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.