DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3663 and Isoc2a

DIOPT Version :9

Sequence 1:NP_611952.1 Gene:CG3663 / 37944 FlyBaseID:FBgn0035044 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001095068.1 Gene:Isoc2a / 664994 MGIID:3609243 Length:206 Species:Mus musculus


Alignment Length:198 Identity:79/198 - (39%)
Similarity:123/198 - (62%) Gaps:9/198 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALRRCHLN---PKKTLFLLCDIQEKFRPAMPLFDNMIKNVDKLTRAGKALDVPLIVTEHYPEKL 62
            ||..|..|.   |:.::..|||:||||||::..|..::....::.:..:.||||:::||.|||.|
Mouse     1 MAAARASLGRILPESSILFLCDLQEKFRPSIAYFPQIVSVAARMLKVARLLDVPILLTEQYPEGL 65

  Fly    63 GKTVAQLDVSHAKLVSGKTLFSMFTPEVKAVIKDI-FNDKPEDVVLYGLESHICVEQTAIDLLEQ 126
            |.||.:|.....:.|| ||.|||    |.|:.|:: ...:.:.|:|.|:|:..|:..||:|||.:
Mouse    66 GPTVPELGAQGIRPVS-KTCFSM----VPALQKELDGRSQLQSVLLCGIETQACILNTALDLLHR 125

  Fly   127 NINVYIVADCCSSRLNQDRDLALDRLRQAGCVITTSESVIFDLVRDKNNPKFDVVRKLVNQPSVD 191
            .:.|::|.|.||||...||.:||.|:||:|..:.||||:|..||||.::|:|..::|::.:|..|
Mouse   126 GLQVHVVVDACSSRSQVDRLVALARMRQSGAFLATSESLILQLVRDASHPQFKEIQKIIKEPVPD 190

  Fly   192 MEL 194
            ..|
Mouse   191 SGL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3663NP_611952.1 YcaC_related 14..171 CDD:238494 65/157 (41%)
Isoc2aNP_001095068.1 YcaC_related 18..170 CDD:238494 65/156 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I4180
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54144
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001690
OrthoInspector 1 1.000 - - mtm8734
orthoMCL 1 0.900 - - OOG6_101675
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3803
SonicParanoid 1 1.000 - - X1084
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.