DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3663 and ISOC1

DIOPT Version :9

Sequence 1:NP_611952.1 Gene:CG3663 / 37944 FlyBaseID:FBgn0035044 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_057132.2 Gene:ISOC1 / 51015 HGNCID:24254 Length:298 Species:Homo sapiens


Alignment Length:181 Identity:81/181 - (44%)
Similarity:124/181 - (68%) Gaps:6/181 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HLNPKKTLFLLCDIQEKFRPAMPLFDNMIKNVDKLTRAGKALDVPLIVTEHYPEKLGKTVAQLDV 71
            :|.|..|:|..||:||:||||:..|.::|....:|.:..:.|.:|:||||.||:.||.||.::|:
Human   109 NLTPSSTVFFCCDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPKGLGSTVQEIDL 173

  Fly    72 SHAKLVSGKTLFSMFTPEVKAVIKDIFNDKP--EDVVLYGLESHICVEQTAIDLLEQNINVYIVA 134
            :..|||..||.|||..|||:|.:.:|    |  ..|||:|:|:|:|::|||::|:.:.:.|:|||
Human   174 TGVKLVLPKTKFSMVLPEVEAALAEI----PGVRSVVLFGVETHVCIQQTALELVGRGVEVHIVA 234

  Fly   135 DCCSSRLNQDRDLALDRLRQAGCVITTSESVIFDLVRDKNNPKFDVVRKLV 185
            |..|||...||..||:||.:.|.::||||:|:..||.||::|||..::.|:
Human   235 DATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3663NP_611952.1 YcaC_related 14..171 CDD:238494 71/158 (45%)
ISOC1NP_057132.2 YcaC_related 116..270 CDD:238494 70/157 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143760
Domainoid 1 1.000 140 1.000 Domainoid score I4758
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9361
Inparanoid 1 1.050 165 1.000 Inparanoid score I4185
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54144
OrthoDB 1 1.010 - - D1100720at2759
OrthoFinder 1 1.000 - - FOG0001690
OrthoInspector 1 1.000 - - mtm8500
orthoMCL 1 0.900 - - OOG6_101675
Panther 1 1.100 - - LDO PTHR14119
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1084
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.