DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3663 and isoc2

DIOPT Version :9

Sequence 1:NP_611952.1 Gene:CG3663 / 37944 FlyBaseID:FBgn0035044 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001073422.2 Gene:isoc2 / 492617 ZFINID:ZDB-GENE-070518-1 Length:197 Species:Danio rerio


Alignment Length:187 Identity:81/187 - (43%)
Similarity:117/187 - (62%) Gaps:3/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LNPKKTLFLLCDIQEKFRPAMPLFDNMIKNVDKLTRAGKALDVPLIVTEHYPEKLGKTVAQLDVS 72
            |:.|.::.||||:||||||.:..|.|::.|..:|.:|.:.|::|.|:||.||:.||.||.:|...
Zfish     7 LSTKGSVLLLCDMQEKFRPTIFQFTNVVSNAARLLQACRILNIPQILTEQYPKGLGPTVPELGAE 71

  Fly    73 HAKLVSGKTLFSMFTPEVKAVIKDIFNDKPEDVVLYGLESHICVEQTAIDLLEQNINVYIVADCC 137
            ..| ...||.|||.|..|::.:|.:  ..|:.|:|.|:|:..|:..||.||||:.:.|:||||..
Zfish    72 GLK-PHTKTSFSMMTESVQSSLKSM--GDPQQVILCGIEAQACIACTAYDLLERGMEVHIVADAV 133

  Fly   138 SSRLNQDRDLALDRLRQAGCVITTSESVIFDLVRDKNNPKFDVVRKLVNQPSVDMEL 194
            |||...||..||.||||:|..:.|:|.|:..||:|..:|.|..::||:..||.|..|
Zfish   134 SSRSQTDRLFALSRLRQSGVFLNTTEGVLLQLVQDAKHPNFKEIQKLLAHPSPDTGL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3663NP_611952.1 YcaC_related 14..171 CDD:238494 69/156 (44%)
isoc2NP_001073422.2 YcaC_related 13..167 CDD:238494 69/156 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4184
OMA 1 1.010 - - QHG54144
OrthoDB 1 1.010 - - D1100720at2759
OrthoFinder 1 1.000 - - FOG0001690
OrthoInspector 1 1.000 - - mtm6468
orthoMCL 1 0.900 - - OOG6_101675
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3803
SonicParanoid 1 1.000 - - X1084
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.