DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3663 and pnc-2

DIOPT Version :9

Sequence 1:NP_611952.1 Gene:CG3663 / 37944 FlyBaseID:FBgn0035044 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001370171.1 Gene:pnc-2 / 3565064 WormBaseID:WBGene00013336 Length:316 Species:Caenorhabditis elegans


Alignment Length:88 Identity:20/88 - (22%)
Similarity:33/88 - (37%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VVLYGLESHICVEQTAIDLLEQNINVYIVADCCSSRLNQDRDLALDRLRQAGCVITTSESVIFDL 169
            |:..||...|||..|..|..:......||........:...|.|....::.|..|...|  :..|
 Worm   227 VIGCGLAYDICVMHTLKDASKHGFLTCIVKSGSKGLSSLKMDEANKMFQKRGVAIIDDE--MAQL 289

  Fly   170 VRDKNNPKFDVVRKLVNQPSVDM 192
            :..:.....:.:|.||:|...::
 Worm   290 ISRREAFPIEWIRLLVHQAQSEL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3663NP_611952.1 YcaC_related 14..171 CDD:238494 16/65 (25%)
pnc-2NP_001370171.1 cysteine_hydrolases 64..282 CDD:381872 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.