Sequence 1: | NP_611951.1 | Gene: | CG4781 / 37943 | FlyBaseID: | FBgn0035043 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094861.1 | Gene: | LINGO3 / 645191 | HGNCID: | 21206 | Length: | 592 | Species: | Homo sapiens |
Alignment Length: | 414 | Identity: | 106/414 - (25%) |
---|---|---|---|
Similarity: | 148/414 - (35%) | Gaps: | 126/414 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 PWGNRALRIDCSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLRHNNISQLVS 124
Fly 125 GNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWN 189
Fly 190 ----------------RRFNESGGDL-------YTGLGVNWKLSTLRLDACSLNDL--------- 222
Fly 223 --------HLPVNAPLKELSLRRNQLKRIPTQLPETLLRLDISDN--LLEELLPEDT--ANLTQV 275
Fly 276 RQLFIEDMPVLQRVVANSLTHVDV--LETLSFQNSRQLSHLDAEAFGPIMTTPTKK--------- 329
Fly 330 -------------------RALRSLSFRGTMLRTFNSTLAPIFTQLAELDLNGLPLQCDCELVWL 375
Fly 376 KQLPVQTN--GR---CYKPARIRG 394 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4781 | NP_611951.1 | leucine-rich repeat | 90..108 | CDD:275380 | 3/17 (18%) |
LRR_8 | 108..167 | CDD:290566 | 23/58 (40%) | ||
leucine-rich repeat | 109..132 | CDD:275380 | 7/22 (32%) | ||
LRR_RI | <121..>261 | CDD:238064 | 53/181 (29%) | ||
leucine-rich repeat | 133..156 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 157..180 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 181..208 | CDD:275380 | 11/49 (22%) | ||
leucine-rich repeat | 230..253 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 254..274 | CDD:275380 | 10/23 (43%) | ||
leucine-rich repeat | 275..299 | CDD:275380 | 3/23 (13%) | ||
leucine-rich repeat | 300..319 | CDD:275380 | 2/18 (11%) | ||
LINGO3 | NP_001094861.1 | LRRNT | 24..58 | CDD:214470 | 7/47 (15%) |
LRR 1 | 55..76 | 6/20 (30%) | |||
LRR_8 | 57..138 | CDD:290566 | 33/80 (41%) | ||
LRR_4 | 59..95 | CDD:289563 | 13/35 (37%) | ||
leucine-rich repeat | 59..79 | CDD:275380 | 7/19 (37%) | ||
LRR 2 | 79..100 | 9/20 (45%) | |||
leucine-rich repeat | 80..103 | CDD:275380 | 10/22 (45%) | ||
LRR 3 | 103..124 | 9/20 (45%) | |||
leucine-rich repeat | 104..127 | CDD:275380 | 10/22 (45%) | ||
LRR_RI | 111..>286 | CDD:238064 | 50/207 (24%) | ||
LRR_8 | 127..>172 | CDD:290566 | 9/44 (20%) | ||
LRR 4 | 127..148 | 5/20 (25%) | |||
leucine-rich repeat | 128..151 | CDD:275380 | 5/22 (23%) | ||
LRR 5 | 151..172 | 4/20 (20%) | |||
leucine-rich repeat | 152..199 | CDD:275380 | 12/49 (24%) | ||
LRR 6 | 175..196 | 6/20 (30%) | |||
LRR_8 | 198..258 | CDD:290566 | 22/88 (25%) | ||
leucine-rich repeat | 200..223 | CDD:275380 | 6/33 (18%) | ||
LRR 7 | 207..228 | 8/31 (26%) | |||
leucine-rich repeat | 224..247 | CDD:275380 | 10/23 (43%) | ||
LRR_8 | 247..303 | CDD:290566 | 12/73 (16%) | ||
LRR 8 | 247..268 | 6/37 (16%) | |||
leucine-rich repeat | 248..271 | CDD:275380 | 5/39 (13%) | ||
LRR 9 | 271..292 | 6/21 (29%) | |||
leucine-rich repeat | 272..293 | CDD:275380 | 6/21 (29%) | ||
LRR 10 | 295..316 | 0/20 (0%) | |||
leucine-rich repeat | 296..319 | CDD:275380 | 0/22 (0%) | ||
LRR 11 | 319..340 | 4/20 (20%) | |||
leucine-rich repeat | 322..343 | CDD:275380 | 3/20 (15%) | ||
I-set | 407..497 | CDD:254352 | |||
Ig | 422..490 | CDD:299845 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165155095 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |