DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and LINGO3

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001094861.1 Gene:LINGO3 / 645191 HGNCID:21206 Length:592 Species:Homo sapiens


Alignment Length:414 Identity:106/414 - (25%)
Similarity:148/414 - (35%) Gaps:126/414 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PWGNRALRIDCSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLRHNNISQLVS 124
            |.|....|.:|:.:...||              .:...|.:||.........|.|..|.|..|..
Human    21 PAGGCPARCECTVQTRAVA--------------CTRRRLTAVPDGIPAETRLLELSRNRIRCLNP 71

  Fly   125 GNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWN 189
            |:...|.:|.||.|..|:|..:|.|:|..||.|:||.|..|.|.|:|..:|..|..|..||:|.|
Human    72 GDLAALPALEELDLSENAIAHVEPGAFANLPRLRVLRLRGNQLKLIPPGVFTRLDNLTLLDLSEN 136

  Fly   190 ----------------RRFNESGGDL-------YTGLGVNWKLSTLRLDACSLNDL--------- 222
                            ||......||       :.||   ..|..|.|:.|:|..|         
Human   137 KLVILLDYTFQDLHSLRRLEVGDNDLVFVSRRAFAGL---LALEELTLERCNLTALSGESLGHLR 198

  Fly   223 --------HLPVNAPLKELSLRRNQLKRIPTQLPETLLRLDISDN--LLEELLPEDT--ANLTQV 275
                    ||.:      .||.....:|:|     .||.|:| ||  ||||:.....  .|||.:
Human   199 SLGALRLRHLAI------ASLEDQNFRRLP-----GLLHLEI-DNWPLLEEVAAGSLRGLNLTSL 251

  Fly   276 RQLFIEDMPVLQRVVANSLTHVDV--LETLSFQNSRQLSHLDAEAFGPIMTTPTKK--------- 329
                             |:||.::  :...:.::...|:.|:. :..||.|.|...         
Human   252 -----------------SVTHTNITAVPAAALRHQAHLTCLNL-SHNPISTVPRGSFRDLVRLRE 298

  Fly   330 -------------------RALRSLSFRGTMLRTFNSTLAPIFTQLAELDLNGLPLQCDCELVWL 375
                               |.:|.|:....:|.|...:.......|..|.::|.||.|||.|:|:
Human   299 LHLAGALLAVVEPQAFLGLRQIRLLNLSNNLLSTLEESTFHSVNTLETLRVDGNPLACDCRLLWI 363

  Fly   376 KQLPVQTN--GR---CYKPARIRG 394
            .|.....|  ||   |..||.:||
Human   364 VQRRKTLNFDGRLPACATPAEVRG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 3/17 (18%)
LRR_8 108..167 CDD:290566 23/58 (40%)
leucine-rich repeat 109..132 CDD:275380 7/22 (32%)
LRR_RI <121..>261 CDD:238064 53/181 (29%)
leucine-rich repeat 133..156 CDD:275380 10/22 (45%)
leucine-rich repeat 157..180 CDD:275380 10/22 (45%)
leucine-rich repeat 181..208 CDD:275380 11/49 (22%)
leucine-rich repeat 230..253 CDD:275380 5/22 (23%)
leucine-rich repeat 254..274 CDD:275380 10/23 (43%)
leucine-rich repeat 275..299 CDD:275380 3/23 (13%)
leucine-rich repeat 300..319 CDD:275380 2/18 (11%)
LINGO3NP_001094861.1 LRRNT 24..58 CDD:214470 7/47 (15%)
LRR 1 55..76 6/20 (30%)
LRR_8 57..138 CDD:290566 33/80 (41%)
LRR_4 59..95 CDD:289563 13/35 (37%)
leucine-rich repeat 59..79 CDD:275380 7/19 (37%)
LRR 2 79..100 9/20 (45%)
leucine-rich repeat 80..103 CDD:275380 10/22 (45%)
LRR 3 103..124 9/20 (45%)
leucine-rich repeat 104..127 CDD:275380 10/22 (45%)
LRR_RI 111..>286 CDD:238064 50/207 (24%)
LRR_8 127..>172 CDD:290566 9/44 (20%)
LRR 4 127..148 5/20 (25%)
leucine-rich repeat 128..151 CDD:275380 5/22 (23%)
LRR 5 151..172 4/20 (20%)
leucine-rich repeat 152..199 CDD:275380 12/49 (24%)
LRR 6 175..196 6/20 (30%)
LRR_8 198..258 CDD:290566 22/88 (25%)
leucine-rich repeat 200..223 CDD:275380 6/33 (18%)
LRR 7 207..228 8/31 (26%)
leucine-rich repeat 224..247 CDD:275380 10/23 (43%)
LRR_8 247..303 CDD:290566 12/73 (16%)
LRR 8 247..268 6/37 (16%)
leucine-rich repeat 248..271 CDD:275380 5/39 (13%)
LRR 9 271..292 6/21 (29%)
leucine-rich repeat 272..293 CDD:275380 6/21 (29%)
LRR 10 295..316 0/20 (0%)
leucine-rich repeat 296..319 CDD:275380 0/22 (0%)
LRR 11 319..340 4/20 (20%)
leucine-rich repeat 322..343 CDD:275380 3/20 (15%)
I-set 407..497 CDD:254352
Ig 422..490 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.