DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and lrrc4.2

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001093494.1 Gene:lrrc4.2 / 566572 ZFINID:ZDB-GENE-030131-7997 Length:644 Species:Danio rerio


Alignment Length:423 Identity:107/423 - (25%)
Similarity:162/423 - (38%) Gaps:102/423 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLEVIRGLTFALLLTQLLAAHVARAEVIDAEETDRFCYPESSKNSRRSCECSNVSASPWGNRALR 67
            ::.|.|....|||....|   :.|:..:.|..:.:...|.       .|.|||||.        :
Zfish     6 QVTVHRAWNAALLCAVYL---MVRSWSVSAAPSGQLTCPS-------VCFCSNVSN--------K 52

  Fly    68 IDCSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLRHNNISQLVSGNFKQLTS 132
            :.|:.:                       :|..||.....:...|||..|:|..:.:|.|:.|..
Zfish    53 VVCTRR-----------------------SLVRVPPGIPATTRHLNLMENSIETIEAGTFQHLRH 94

  Fly   133 LRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWNR------- 190
            |..|.||.|||.::|.|:|.||..|..|:|..|.|.::|...|..|..|..|   |.|       
Zfish    95 LEVLQLGRNSIRQIEVGAFSGLNSLNTLELFDNRLTVIPSGAFEYLSKLREL---WLRSNPIESI 156

  Fly   191 ---RFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPVNAPLKELSLRRNQLKRIPTQLPET-L 251
               .||.....:...||...||..:...|  ...||     .||.|:|....|:.:|...|.. |
Zfish   157 PSYAFNRVPSLMRLDLGELRKLEYISEGA--FEGLH-----NLKYLNLGMCNLREMPVLTPLVGL 214

  Fly   252 LRLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVLETLSFQNSRQLSHLDA 316
            ..|::|:|...||.|.....|..:::|:|.:..: ..:..|:...|..|..|:..:: .||.|..
Zfish   215 EELEMSENYFPELKPGSFRGLKSLKKLWIMNSRI-TTIERNAFDDVTALVELNLAHN-NLSSLPH 277

  Fly   317 EAFGPIMTTPTKKRALRSLSFRGTMLRTFNSTLAPIFTQLAELDLNGLPLQCDCELVWL-----K 376
            :.|.|:                               :.|.||.|:..|.:|||::|||     :
Zfish   278 DLFAPL-------------------------------SYLVELHLHHNPWRCDCDVVWLAWWLRE 311

  Fly   377 QLPVQTN--GRCYKPARIRGMLVTSARGDAFSC 407
            .:|..:.  |||:.||.:||..:.......|.|
Zfish   312 YIPTNSTCCGRCHTPAYLRGRYLVEVDQSTFQC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 3/17 (18%)
LRR_8 108..167 CDD:290566 24/58 (41%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
LRR_RI <121..>261 CDD:238064 47/150 (31%)
leucine-rich repeat 133..156 CDD:275380 12/22 (55%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
leucine-rich repeat 181..208 CDD:275380 8/36 (22%)
leucine-rich repeat 230..253 CDD:275380 8/23 (35%)
leucine-rich repeat 254..274 CDD:275380 7/19 (37%)
leucine-rich repeat 275..299 CDD:275380 4/23 (17%)
leucine-rich repeat 300..319 CDD:275380 5/18 (28%)
lrrc4.2NP_001093494.1 leucine-rich repeat 71..94 CDD:275380 8/22 (36%)
LRR_8 72..129 CDD:290566 24/56 (43%)
LRR_RI 74..>276 CDD:238064 64/213 (30%)
leucine-rich repeat 95..118 CDD:275380 12/22 (55%)
leucine-rich repeat 119..142 CDD:275380 8/22 (36%)
LRR_8 141..202 CDD:290566 17/70 (24%)
leucine-rich repeat 143..166 CDD:275380 6/25 (24%)
leucine-rich repeat 167..191 CDD:275380 7/30 (23%)
leucine-rich repeat 192..213 CDD:275380 7/20 (35%)
LRR_8 213..272 CDD:290566 14/60 (23%)
leucine-rich repeat 214..237 CDD:275380 8/22 (36%)
leucine-rich repeat 238..261 CDD:275380 4/23 (17%)
leucine-rich repeat 262..283 CDD:275380 6/21 (29%)
LRRCT 294..345 CDD:214507 17/51 (33%)
IG_like 353..435 CDD:214653
Ig 365..435 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.