DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and lrrc4ca

DIOPT Version :10

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001018583.1 Gene:lrrc4ca / 553785 ZFINID:ZDB-GENE-050522-533 Length:647 Species:Danio rerio


Alignment Length:416 Identity:98/416 - (23%)
Similarity:152/416 - (36%) Gaps:115/416 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALLLTQLLAAHVARAEVIDAEETDRFCYPESSKNSRRSCECSNVSASPWGNRALRIDCSYKDYKV 77
            :|.|..|:.|.:.||:...:                 .|.||        |:..::.|:.:    
Zfish    31 SLALQLLVVAGLVRAQTCPS-----------------VCSCS--------NQFSKVICTRR---- 66

  Fly    78 ADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLRHNNISQLVSGNFKQLTSLRELYLGWNS 142
                               .|..||...|.:...|||:.|.|..:...:||.|..|..|.|..|.
Zfish    67 -------------------GLRDVPDGISTNTRYLNLQENLIQVIKVDSFKHLRHLEILQLSKNH 112

  Fly   143 IGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWNRRFNESGGDLYTGLGVNW 207
            |..:|.|:|:||.:|..|:|..|.|..:|...|..|..|..|   |.|   .:..:.......|.
Zfish   113 IRNIEIGAFNGLANLNTLELFDNRLTTIPNGAFEYLSKLKEL---WLR---NNPIESIPSYAFNR 171

  Fly   208 KLSTLRLDACSLNDL-HLPVNA-----PLKELSLRRNQLKRIPTQLPETLLRLD---ISDNLLEE 263
            ..|..|||...|..| ::...|     .|:.|:|....||.||..:|  |:|||   :|.|.|..
Zfish   172 VPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLGMCNLKEIPNLIP--LVRLDELEMSGNQLSI 234

  Fly   264 LLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVLETLSFQNSRQLSHLDAEAFGPIMTTPTK 328
            :.|.....|..:::|::..            ..:..:|..:|.:.:.|..|:             
Zfish   235 IRPGSFKGLVHLQKLWMMH------------AQIQTIERNAFDDLQSLVELN------------- 274

  Fly   329 KRALRSLSFRGTMLRTFNSTLAP--IFTQLAELD---LNGLPLQCDCELVWL-----KQLPVQTN 383
                         |...|.||.|  :||.|..|:   |:..|..|:|:::||     :.:|..|:
Zfish   275 -------------LAHNNLTLLPHDLFTPLHHLERVHLHHNPWNCNCDILWLSWWLKEMVPANTS 326

  Fly   384 --GRCYKPARIRGMLVTSARGDAFSC 407
              .||..|...:|..:.....:.|.|
Zfish   327 CCARCSSPTSHKGRYIGELDQNYFHC 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 LRR <90..367 CDD:443914 75/290 (26%)
leucine-rich repeat 90..108 CDD:275380 4/17 (24%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
leucine-rich repeat 133..156 CDD:275380 10/22 (45%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
leucine-rich repeat 181..208 CDD:275380 5/26 (19%)
leucine-rich repeat 230..253 CDD:275380 9/22 (41%)
leucine-rich repeat 254..274 CDD:275380 7/22 (32%)
leucine-rich repeat 275..299 CDD:275380 1/23 (4%)
leucine-rich repeat 300..319 CDD:275380 4/18 (22%)
lrrc4caNP_001018583.1 LRRNT 48..81 CDD:214470 9/80 (11%)
LRR <77..326 CDD:443914 76/294 (26%)
leucine-rich repeat 79..102 CDD:275380 8/22 (36%)
leucine-rich repeat 103..126 CDD:275380 10/22 (45%)
leucine-rich repeat 127..150 CDD:275380 8/22 (36%)
leucine-rich repeat 151..174 CDD:275380 5/28 (18%)
leucine-rich repeat 175..199 CDD:275380 6/23 (26%)
leucine-rich repeat 200..221 CDD:275380 9/22 (41%)
leucine-rich repeat 222..245 CDD:275380 7/22 (32%)
leucine-rich repeat 246..269 CDD:275380 3/34 (9%)
leucine-rich repeat 270..291 CDD:275380 9/46 (20%)
IG_like 361..443 CDD:214653
Ig strand B 372..376 CDD:409353
Ig strand C 383..387 CDD:409353
Ig strand E 409..413 CDD:409353
Ig strand F 423..428 CDD:409353
Ig strand G 436..439 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.