| Sequence 1: | NP_611951.1 | Gene: | CG4781 / 37943 | FlyBaseID: | FBgn0035043 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001018560.1 | Gene: | zgc:113307 / 553753 | ZFINID: | ZDB-GENE-050522-29 | Length: | 343 | Species: | Danio rerio |
| Alignment Length: | 220 | Identity: | 72/220 - (32%) |
|---|---|---|---|
| Similarity: | 101/220 - (45%) | Gaps: | 30/220 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 62 GNRALRIDCSYKDYKVADLSLLLPLYID-----------SLDLSWNALDSVPIFTSDSLHQLNLR 115
Fly 116 HNNISQLVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLV 180
Fly 181 LGTLDISWNRRFNESGGDL-------YTGLGVNWKLSTLRLDACSLNDLHLPVNAPLKELSLRRN 238
Fly 239 QLKRIPTQLPETLLRLDISDNLLEE 263 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4781 | NP_611951.1 | leucine-rich repeat | 90..108 | CDD:275380 | 5/17 (29%) |
| LRR_8 | 108..167 | CDD:290566 | 24/58 (41%) | ||
| leucine-rich repeat | 109..132 | CDD:275380 | 9/22 (41%) | ||
| LRR_RI | <121..>261 | CDD:238064 | 52/146 (36%) | ||
| leucine-rich repeat | 133..156 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 157..180 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 181..208 | CDD:275380 | 9/33 (27%) | ||
| leucine-rich repeat | 230..253 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 254..274 | CDD:275380 | 3/10 (30%) | ||
| leucine-rich repeat | 275..299 | CDD:275380 | |||
| leucine-rich repeat | 300..319 | CDD:275380 | |||
| zgc:113307 | NP_001018560.1 | LRRNT | 41..70 | CDD:214470 | |
| leucine-rich repeat | 56..72 | CDD:275380 | |||
| LRR_RI | <60..274 | CDD:238064 | 64/197 (32%) | ||
| LRR_8 | 72..133 | CDD:290566 | 10/46 (22%) | ||
| leucine-rich repeat | 73..96 | CDD:275380 | 3/9 (33%) | ||
| leucine-rich repeat | 97..122 | CDD:275380 | 4/24 (17%) | ||
| leucine-rich repeat | 123..146 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 142..200 | CDD:290566 | 22/57 (39%) | ||
| leucine-rich repeat | 147..167 | CDD:275380 | 7/19 (37%) | ||
| leucine-rich repeat | 168..191 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 192..212 | CDD:275380 | 11/21 (52%) | ||
| LRR_8 | 211..272 | CDD:290566 | 21/68 (31%) | ||
| leucine-rich repeat | 213..236 | CDD:275380 | 6/23 (26%) | ||
| leucine-rich repeat | 237..261 | CDD:275380 | 10/30 (33%) | ||
| leucine-rich repeat | 282..311 | CDD:275380 | 4/13 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||