DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and Tollo

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster


Alignment Length:333 Identity:93/333 - (27%)
Similarity:149/333 - (44%) Gaps:78/333 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LLPLYIDSLDLSWNALDSVP--IFT-SDSLHQLNLRHNNISQLVSGNFKQLTSL-------RELY 137
            ||.|.:  :|||.|.|.|:|  :|. :..|.::.||:|:|:.|..|.|.:|..|       .||.
  Fly   257 LLSLRV--VDLSANRLTSLPPELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLASNELN 319

  Fly   138 LGW-------------------NSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGT 183
            ..|                   |.|.:||:..|..|..||:|.|..|.:..|||.:||.|..|.|
  Fly   320 SQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLTNLHT 384

  Fly   184 LDISWNRRFNESGGDLYTGLGV-NWKLSTLRLDACSLNDLHLPVN-APLKELSLRRNQLKRIPTQ 246
            |.:|.||   .|..:..|..|: |..:.:|..:..|..|....|| :.|::|.|..|:|:.:|..
  Fly   385 LILSRNR---ISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQAVPEA 446

  Fly   247 LP--ETLLRLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHV-----DVLETLS 304
            |.  :.|..||:.:|::.::   :..::||:..|:      ..|:..|||||:     |.:.:|.
  Fly   447 LAHVQLLKTLDVGENMISQI---ENTSITQLESLY------GLRMTENSLTHIRRGVFDRMSSLQ 502

  Fly   305 FQNSRQ--LSHLDAEAFGPIMTTPTKKRALRSLSFRGTMLRTFNSTLAPIFTQLAELDLNGLPLQ 367
            ..|..|  |..::|.:.       .:...|:::...|..|:    ::|.:||:|.          
  Fly   503 ILNLSQNKLKSIEAGSL-------QRNSQLQAIRLDGNQLK----SIAGLFTELP---------- 546

  Fly   368 CDCELVWL 375
               .||||
  Fly   547 ---NLVWL 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 8/20 (40%)
LRR_8 108..167 CDD:290566 24/84 (29%)
leucine-rich repeat 109..132 CDD:275380 9/22 (41%)
LRR_RI <121..>261 CDD:238064 51/169 (30%)
leucine-rich repeat 133..156 CDD:275380 10/48 (21%)
leucine-rich repeat 157..180 CDD:275380 11/22 (50%)
leucine-rich repeat 181..208 CDD:275380 10/27 (37%)
leucine-rich repeat 230..253 CDD:275380 8/24 (33%)
leucine-rich repeat 254..274 CDD:275380 3/19 (16%)
leucine-rich repeat 275..299 CDD:275380 7/28 (25%)
leucine-rich repeat 300..319 CDD:275380 5/20 (25%)
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 11/25 (44%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR 210..656 CDD:227223 93/333 (28%)
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380 1/1 (100%)
leucine-rich repeat 260..283 CDD:275380 9/24 (38%)
LRR_RI 276..558 CDD:238064 83/312 (27%)
leucine-rich repeat 284..307 CDD:275380 9/22 (41%)
leucine-rich repeat 308..333 CDD:275380 4/24 (17%)
leucine-rich repeat 334..357 CDD:275380 6/22 (27%)
leucine-rich repeat 358..381 CDD:275380 11/22 (50%)
leucine-rich repeat 382..405 CDD:275380 9/25 (36%)
leucine-rich repeat 406..429 CDD:275380 5/22 (23%)
leucine-rich repeat 430..452 CDD:275380 7/21 (33%)
leucine-rich repeat 453..500 CDD:275380 14/55 (25%)
leucine-rich repeat 501..521 CDD:275380 5/26 (19%)
leucine-rich repeat 525..547 CDD:275380 7/38 (18%)
leucine-rich repeat 548..573 CDD:275380 4/4 (100%)
leucine-rich repeat 604..640 CDD:275380
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.