DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and atk

DIOPT Version :10

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_649228.1 Gene:atk / 40266 FlyBaseID:FBgn0036995 Length:1535 Species:Drosophila melanogaster


Alignment Length:569 Identity:129/569 - (22%)
Similarity:195/569 - (34%) Gaps:176/569 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IRGL-----TFALLLTQLLAAHVARAEVIDAEETDRFCYPESSKNSRRS---CECSNVSASPWG- 62
            ::||     .||.:.:||||. :.....:|..|....   |.:.||.|.   .|..|:|::... 
  Fly   432 LKGLDLAQNQFARVDSQLLAG-LPSLRRLDLSENGLI---ELAPNSFRHNPLLETLNISSNELTK 492

  Fly    63 ---------NRALRIDCSYKDYKVADLSLL--LPLYIDSLDLSWNALDSVPIFTSDSLHQLNLR- 115
                     .|...:|.||...|    |::  ||..::.:.|..|.:.|:|...|..|...||| 
  Fly   493 IHSSTLIHLERLFEVDASYNQLK----SVIAGLPRIVERISLKGNQITSLPAAASKDLQLPNLRM 553

  Fly   116 ----HNNISQLVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFA 176
                .|.|.||....|:....||.|.|..|.:.:|:..||.|:..|::|.|..|.|.........
  Fly   554 LDLSQNRIEQLPRHGFQGAMELRVLSLAQNELRQLKDTSFIGIQRLELLHLQENQLGEADERALL 618

  Fly   177 PLLVLGTLDISWNR------RFNESGGDLY--------------TGLGVNWKLSTLRLDACSLND 221
            ||..|..|::..|:      .|..:...|.              |.......|..|.|...:|.|
  Fly   619 PLAELRNLNLQSNKLEAITDNFFSNNSRLEQLDLSRNLIRSISPTAFDTQRSLEYLDLSGNALLD 683

  Fly   222 LHLPVN--APLKELSLRRNQLKRIPT----------------------------QLPETLLRLDI 256
            :.:.:.  ..|:::.|..||:.||.:                            .||: |..||:
  Fly   684 ISVGLGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNNLIVELQQGTFRNLPK-LQYLDL 747

  Fly   257 SDNLLEELLPEDTANLTQVRQLFI-------------EDMPVL---------QRVV-------AN 292
            |.|.:..:.|.....|.::::..:             |::|.|         .|.:       ||
  Fly   748 SSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQYNKLRYISPESFHNAN 812

  Fly   293 SL-------THVDVLETLSFQNSRQLSHLDAEAFGP--IMTTPTK-------------------- 328
            ||       .|...:|.:..::.|.|..||....|.  :.|.|.|                    
  Fly   813 SLVFLNLSNNHFRNMENIGLRSMRNLEVLDLSTNGVKLVSTMPLKALNWLVELKMDNNQICRIQG 877

  Fly   329 -----KRALRSLSFRGTMLRTFNS-TLAPIFTQLAELDLNGLPLQCDCELVWLKQLPVQTN---- 383
                 ...||.||.|...||:... |...:...:|.||::|.|:.|:||:.||.....:||    
  Fly   878 SPFETMPRLRVLSMRNNQLRSIKERTFRNVRGNIAILDVDGNPIDCNCEMQWLSVWLQETNFPYP 942

  Fly   384 ------GRCYKPARIRGMLVTSA------------------RGDAFSCD 408
                  ||..:.||:...|...|                  .||.|..|
  Fly   943 GPKCQDGRLLRSARMERSLCVGADIYGNERTDGNQLPLLNEHGDVFQRD 991

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 LRR <90..367 CDD:443914 87/395 (22%)
leucine-rich repeat 90..108 CDD:275380 5/17 (29%)
leucine-rich repeat 109..132 CDD:275380 9/27 (33%)
leucine-rich repeat 133..156 CDD:275380 9/22 (41%)
leucine-rich repeat 157..180 CDD:275380 7/22 (32%)
leucine-rich repeat 181..208 CDD:275380 6/46 (13%)
leucine-rich repeat 230..253 CDD:275380 9/50 (18%)
leucine-rich repeat 254..274 CDD:275380 6/19 (32%)
leucine-rich repeat 275..299 CDD:275380 9/59 (15%)
leucine-rich repeat 300..319 CDD:275380 5/18 (28%)
atkNP_649228.1 leucine-rich repeat 886..906 CDD:275380 8/19 (42%)
PCC 891..>936 CDD:188093 14/44 (32%)
leucine-rich repeat 69..89 CDD:275380
leucine-rich repeat 90..113 CDD:275380
LRR 93..530 CDD:443914 25/105 (24%)
leucine-rich repeat 115..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380
leucine-rich repeat 185..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..359 CDD:275380
leucine-rich repeat 334..348 CDD:275378
PLN00113 359..>824 CDD:215061 89/400 (22%)
leucine-rich repeat 360..383 CDD:275380
leucine-rich repeat 384..407 CDD:275380
leucine-rich repeat 408..431 CDD:275380
leucine-rich repeat 432..455 CDD:275380 8/23 (35%)
leucine-rich repeat 456..476 CDD:275380 5/22 (23%)
leucine-rich repeat 480..501 CDD:275380 3/20 (15%)
leucine-rich repeat 505..517 CDD:275378 4/15 (27%)
leucine-rich repeat 525..550 CDD:275380 6/24 (25%)
leucine-rich repeat 551..574 CDD:275380 7/22 (32%)
leucine-rich repeat 575..598 CDD:275380 9/22 (41%)
leucine-rich repeat 599..622 CDD:275380 7/22 (32%)
leucine-rich repeat 623..646 CDD:275380 4/22 (18%)
leucine-rich repeat 647..670 CDD:275380 2/22 (9%)
leucine-rich repeat 671..693 CDD:275380 5/21 (24%)
leucine-rich repeat 694..717 CDD:275380 6/22 (27%)
leucine-rich repeat 718..741 CDD:275380 1/22 (5%)
leucine-rich repeat 742..763 CDD:275380 6/20 (30%)
leucine-rich repeat 766..789 CDD:275380 1/22 (5%)
leucine-rich repeat 790..813 CDD:275380 3/22 (14%)
leucine-rich repeat 814..835 CDD:275380 3/20 (15%)
leucine-rich repeat 838..861 CDD:275380 7/22 (32%)
leucine-rich repeat 862..885 CDD:275380 0/22 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.