DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and CG6749

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster


Alignment Length:363 Identity:94/363 - (25%)
Similarity:133/363 - (36%) Gaps:116/363 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GNRALRIDCSYKDYKVADLSLLLPL-YIDSLDLSWNALDSV--PIFTSDS-----LHQLNLRHNN 118
            |||...|          .|....|| .:..|:||.||||::  .:|.:..     |.||:|..|.
  Fly   227 GNRLSSI----------GLETFQPLAQLRKLNLSQNALDALRPNVFGAVQNFVLHLQQLDLSGNR 281

  Fly   119 ISQLVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGT 183
            |..|....|:.|..|:.|.:..|||..|....|.||..|:.|.|.:|.:..:....||.||.|.|
  Fly   282 IRLLFDNQFRVLARLQMLDVSRNSIASLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDT 346

  Fly   184 LDISWNR-RFNES---GGDLYTGLGVNWKLSTLRLDACSLNDLH------LPVNAPLKELSLRRN 238
            ||:|:|. .|.|.   ||:...      ::..|.|:...:..||      ||.   |:.|.|..|
  Fly   347 LDLSYNNLEFLEEQIFGGNTLP------RMRRLNLNGNRMKHLHPLAFSSLPF---LEYLKLGHN 402

  Fly   239 QLKRIPTQL---PETLLRLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVL 300
            :||.:..::   ...|.:|.:..|||||:                               ::|||
  Fly   403 ELKSLDVRMFAPMRRLQKLHLGHNLLEEI-------------------------------NLDVL 436

  Fly   301 ETLS------FQNSRQLSHLDAEAFGPIMTTPTKKRALRSLSFRGTMLRTFNSTLAPIFTQLAEL 359
            |:||      ..|:|                                 .||.:.:...|..|..:
  Fly   437 ESLSSVQEILVDNNR---------------------------------LTFLAKVNVSFPNLKRV 468

  Fly   360 DLNGLPLQCDCELV---WLKQLPV---QTNGRCYKPAR 391
            .:.|.|.||.|.:.   ||....|   :.|...||..|
  Fly   469 AIEGNPWQCPCFVKLQHWLATRDVVYLRDNTGYYKGER 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 8/19 (42%)
LRR_8 108..167 CDD:290566 22/63 (35%)
leucine-rich repeat 109..132 CDD:275380 9/22 (41%)
LRR_RI <121..>261 CDD:238064 45/152 (30%)
leucine-rich repeat 133..156 CDD:275380 9/22 (41%)
leucine-rich repeat 157..180 CDD:275380 7/22 (32%)
leucine-rich repeat 181..208 CDD:275380 10/30 (33%)
leucine-rich repeat 230..253 CDD:275380 7/25 (28%)
leucine-rich repeat 254..274 CDD:275380 6/19 (32%)
leucine-rich repeat 275..299 CDD:275380 0/23 (0%)
leucine-rich repeat 300..319 CDD:275380 6/24 (25%)
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 13/38 (34%)
LRR_8 104..164 CDD:290566
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..153 CDD:275380
leucine-rich repeat 154..195 CDD:275380
LRR_RI 194..455 CDD:238064 79/310 (25%)
LRR_8 194..254 CDD:290566 11/36 (31%)
leucine-rich repeat 196..219 CDD:275380
leucine-rich repeat 220..243 CDD:275380 7/25 (28%)
leucine-rich repeat 244..267 CDD:275380 8/22 (36%)
LRR_8 271..330 CDD:290566 22/58 (38%)
leucine-rich repeat 272..295 CDD:275380 9/22 (41%)
leucine-rich repeat 296..319 CDD:275380 9/22 (41%)
LRR_8 319..380 CDD:290566 20/66 (30%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..369 CDD:275380 10/30 (33%)
LRR_8 368..428 CDD:290566 15/68 (22%)
leucine-rich repeat 370..393 CDD:275380 5/22 (23%)
leucine-rich repeat 394..417 CDD:275380 6/22 (27%)
leucine-rich repeat 418..441 CDD:275380 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.