DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and Con

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001246635.1 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster


Alignment Length:414 Identity:102/414 - (24%)
Similarity:152/414 - (36%) Gaps:128/414 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLRHNNISQLVSGNFKQLTSLRELY 137
            |.|..|:|..|..:.:::..:.  |||.........|.:|||.||.|.::....|:.|.....|:
  Fly   199 KSYAFANLPFLERIILNNNHIM--ALDQDAFANHIRLRELNLEHNQIFEMDRYAFRNLPLCERLF 261

  Fly   138 LGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWNRRFNESGGDLYTG 202
            |..|:|..|..|.|..:..|..|:||||.:::|...:|..|..|..|.::.| ..|..|..::..
  Fly   262 LNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFRGLGNLNVLKLTRN-NLNFIGDTVFAE 325

  Fly   203 LGVNWKLSTLRLD--------ACSLNDLHLPVNAPLKELSLRRNQLKRIPTQLPETLLRLDISDN 259
            |   |.||.|.||        ..:|:.|:     .||.|:||.|.||:|              ||
  Fly   326 L---WSLSELELDDNRIERISERALDGLN-----TLKTLNLRNNLLKKI--------------DN 368

  Fly   260 LLEELLPEDTANLTQVRQLFIEDMPVLQ--RVVANSLTHVDVLETLSFQNSRQLSHLDAEAFGPI 322
            .|                  :...|.|.  .|.||.      ||||:|.           .|.||
  Fly   369 GL------------------LRGTPALLSINVQANK------LETLTFY-----------TFQPI 398

  Fly   323 MTTPTKKRALRSLSFRGTMLRTFNSTLAPIFTQLAELDLNGLPLQCDCELVWLKQLPVQTNGRCY 387
            |.                  ...|||        :||.::.....|||.|.|:.:|..:|     
  Fly   399 MD------------------NLVNST--------SELLVSDNKFICDCRLQWIFELKNRT----- 432

  Fly   388 KPARIRGMLVTSARGDAFSCDTWPRWAYG--------LVVLSLIALSAAGIYLIVMGLRPHRGVT 444
                 |.:.:..:..|.......|:.::.        |.||::...:|.|.....||        
  Fly   433 -----RHLQLRDSLEDLHCTLQEPKLSHFVDPVPPTILDVLNIGGFTAIGSNSASMG-------- 484

  Fly   445 MRRKVG---AGSPYARVTIEPNRQ 465
               .||   .||.|:.:|::.:|:
  Fly   485 ---GVGNSVVGSSYSGLTMDDSRK 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 3/17 (18%)
LRR_8 108..167 CDD:290566 22/58 (38%)
leucine-rich repeat 109..132 CDD:275380 9/22 (41%)
LRR_RI <121..>261 CDD:238064 43/147 (29%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
leucine-rich repeat 157..180 CDD:275380 9/22 (41%)
leucine-rich repeat 181..208 CDD:275380 6/26 (23%)
leucine-rich repeat 230..253 CDD:275380 9/22 (41%)
leucine-rich repeat 254..274 CDD:275380 3/19 (16%)
leucine-rich repeat 275..299 CDD:275380 5/25 (20%)
leucine-rich repeat 300..319 CDD:275380 5/18 (28%)
ConNP_001246635.1 LRR_RI <147..291 CDD:238064 30/93 (32%)
LRR_8 183..243 CDD:290566 14/45 (31%)
leucine-rich repeat 185..208 CDD:275380 4/8 (50%)
leucine-rich repeat 209..232 CDD:275380 4/24 (17%)
LRR_RI <225..416 CDD:238064 70/274 (26%)
LRR_8 232..291 CDD:290566 22/58 (38%)
leucine-rich repeat 233..256 CDD:275380 9/22 (41%)
leucine-rich repeat 257..280 CDD:275380 7/22 (32%)
leucine-rich repeat 281..304 CDD:275380 9/22 (41%)
LRR_8 304..363 CDD:290566 20/67 (30%)
leucine-rich repeat 305..328 CDD:275380 6/26 (23%)
leucine-rich repeat 329..352 CDD:275380 7/27 (26%)
LRR_8 352..416 CDD:290566 31/138 (22%)
leucine-rich repeat 353..376 CDD:275380 12/54 (22%)
LRRCT 414..>450 CDD:214507 9/45 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.