DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and Con

DIOPT Version :10

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_523930.3 Gene:Con / 38590 FlyBaseID:FBgn0005775 Length:691 Species:Drosophila melanogaster


Alignment Length:209 Identity:40/209 - (19%)
Similarity:66/209 - (31%) Gaps:53/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 WYESGACRKLWPLATTGDGNCLLHAASLAMWGFHDRRLTLRRTLHDILSKEEFREALYRRWR--- 95
            ||.|...:.|.|.  :|:....|.......:|:....|:..   .:..::....|.::.||.   
  Fly    50 WYGSDRVKYLGPF--SGESPSYLTGEFPGDYGWDTAGLSAD---PETFARNRELEVIHSRWAMLG 109

  Fly    96 -----FQQTRVNKQAGFVFCESEWAKEWEEIVAIASPEPRRNSKSTGPSRRRSLEDVNATYESLE 155
                 |.:.....  |..|.|:.|.|...:|.:....:...|     ||.               
  Fly   110 ALGCVFPELLARN--GVKFGEAVWFKAGSQIFSDGGLDYLGN-----PSL--------------- 152

  Fly   156 EIHVLALAHILRRTIIVVSDVFLRDIN-----GEAFSPIPFGGVYLPFEVPSNECHRAPLLLAYD 215
             :|..::..|....:|::..|....:.     |||...:..||.:            .||.||.|
  Fly   153 -VHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSF------------DPLGLATD 204

  Fly   216 MAHFSALVAMEASN 229
            ...|:.|...|..|
  Fly   205 PEAFAELKVKELKN 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 LRR <90..367 CDD:443914 30/153 (20%)
leucine-rich repeat 90..108 CDD:275380 4/25 (16%)
leucine-rich repeat 109..132 CDD:275380 5/22 (23%)
leucine-rich repeat 133..156 CDD:275380 2/22 (9%)
leucine-rich repeat 157..180 CDD:275380 4/22 (18%)
leucine-rich repeat 181..208 CDD:275380 5/31 (16%)
leucine-rich repeat 230..253 CDD:275380 40/209 (19%)
leucine-rich repeat 254..274 CDD:275380
leucine-rich repeat 275..299 CDD:275380
leucine-rich repeat 300..319 CDD:275380
ConNP_523930.3 LRR <157..459 CDD:443914 17/74 (23%)
leucine-rich repeat 185..208 CDD:275380 9/34 (26%)
leucine-rich repeat 209..232 CDD:275380 3/10 (30%)
leucine-rich repeat 233..256 CDD:275380
leucine-rich repeat 257..280 CDD:275380
leucine-rich repeat 281..304 CDD:275380
leucine-rich repeat 305..328 CDD:275380
leucine-rich repeat 329..352 CDD:275380
leucine-rich repeat 353..376 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.