DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and 18w

DIOPT Version :10

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0287775 Length:1385 Species:Drosophila melanogaster


Alignment Length:452 Identity:109/452 - (24%)
Similarity:155/452 - (34%) Gaps:163/452 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LDLSWNALDSVPIFTSD-----SLHQLNLRHNNISQLVSGNFKQLTSLRELYLGWNSIGKLESGS 150
            ||||.|.|.|..:..|.     .|..|||.:|.::::.|..||:|..|:.|.:..||||.:|.|:
  Fly   312 LDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIEEGA 376

  Fly   151 FDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWNRRFNESGGDLYTGLGVNWKLSTLRLD 215
            |..|.:|..|:||.|.||              |||   ||.||        ||.|..|| ||..:
  Fly   377 FLPLYNLHTLNLAENRLH--------------TLD---NRIFN--------GLYVLTKL-TLNNN 415

  Fly   216 ACSLNDLHLPVN-APLKELSLRRNQLKRIPTQLPE--TLLRLDISDNLLEELLPEDTANLTQVRQ 277
            ..|:.:.....| :.||||.|..|||..:|..:.:  .|..||:.:|.:.|.......||.|:..
  Fly   416 LVSIVESQAFRNCSDLKELDLSSNQLTEVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTG 480

  Fly   278 L-------------FIEDMPVLQ--------------------------RVVANSLT-------- 295
            |             ..:|:|.|.                          |:..|.||        
  Fly   481 LRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTEIEAIRLDKNFLTDINGIFAT 545

  Fly   296 -------------------------------HVDVLETL-------------------------- 303
                                           |.:.:|.|                          
  Fly   546 LASLLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVTTLDASHNRITEIG 610

  Fly   304 --SFQNSRQLSHLDAEAFGPIM-TTPTKKRALRSLSFRGTMLRTFNST---LAPIFTQ--LAELD 360
              |..||.:|..::....|.|. .|...|..|..:.....:|...:..   :||:..:  :.|..
  Fly   611 AMSVPNSIELLFINNNIIGQIQANTFVDKTRLARVDLYANVLSKISLNALRVAPVSAEKPVPEFY 675

  Fly   361 LNGLPLQCDCELVWLKQLPVQT-----------NGRCYKP----ARIRGMLVTSARGDAFSC 407
            |.|.|.:|||.:.||:::...|           |..|..|    |.:|.:...||  ..|.|
  Fly   676 LGGNPFECDCSMEWLQRINNLTTRQHPHVVDLGNIECLMPHSRSAPLRPLASLSA--SDFVC 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 LRR <90..367 CDD:443914 94/395 (24%)
leucine-rich repeat 90..108 CDD:275380 8/21 (38%)
leucine-rich repeat 109..132 CDD:275380 9/22 (41%)
leucine-rich repeat 133..156 CDD:275380 10/22 (45%)
leucine-rich repeat 157..180 CDD:275380 7/22 (32%)
leucine-rich repeat 181..208 CDD:275380 10/26 (38%)
leucine-rich repeat 230..253 CDD:275380 10/24 (42%)
leucine-rich repeat 254..274 CDD:275380 6/19 (32%)
leucine-rich repeat 275..299 CDD:275380 9/101 (9%)
leucine-rich repeat 300..319 CDD:275380 6/46 (13%)
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:404697
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380
LRR 210..592 CDD:443914 78/305 (26%)
leucine-rich repeat 212..236 CDD:275380
leucine-rich repeat 237..260 CDD:275380
leucine-rich repeat 261..284 CDD:275380
leucine-rich repeat 285..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380 8/21 (38%)
leucine-rich repeat 335..358 CDD:275380 9/22 (41%)
leucine-rich repeat 359..382 CDD:275380 10/22 (45%)
leucine-rich repeat 383..406 CDD:275380 16/47 (34%)
leucine-rich repeat 407..430 CDD:275380 6/23 (26%)
leucine-rich repeat 431..451 CDD:275380 9/19 (47%)
leucine-rich repeat 454..477 CDD:275380 7/22 (32%)
leucine-rich repeat 478..499 CDD:275380 1/20 (5%)
leucine-rich repeat 502..525 CDD:275380 1/22 (5%)
leucine-rich repeat 526..548 CDD:275380 4/21 (19%)
leucine-rich repeat 590..617 CDD:275380 1/26 (4%)
leucine-rich repeat 618..641 CDD:275380 5/22 (23%)
leucine-rich repeat 642..689 CDD:275380 11/46 (24%)
LRRCT 679..736 CDD:214507 16/59 (27%)
LRR <775..>920 CDD:443914
leucine-rich repeat 775..796 CDD:275380
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
leucine-rich repeat 842..865 CDD:275380
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.