DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and CG4168

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001285953.1 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster


Alignment Length:314 Identity:92/314 - (29%)
Similarity:152/314 - (48%) Gaps:46/314 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KVADLSLLLPLYIDS------LDLSWNALDSV--PIFTSDSLHQLNLRHNNISQLVSGNFKQL-T 131
            ::..|||...||:.:      |::|.|.:.|.  .:.:...::||::.||::::  |.:|..| .
  Fly   721 QLCSLSLKSFLYVSNTTTPLRLNVSHNHIASFYDELSSYMYIYQLDISHNHVTK--SDSFTNLAN 783

  Fly   132 SLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWNRRFNESG 196
            :||.|.|..|.:|.|:|.:|..|..|::|::|||||..|....|..|..|..||:|.| :.::..
  Fly   784 TLRFLNLAHNQLGSLQSHAFGDLEFLEILNVAHNNLTSLRRRSFQGLNSLQELDLSHN-QLDQLQ 847

  Fly   197 GDLYTGLGVNWKLSTLRLDACSLNDLHLPV--NAPLKELSLRRNQLKRIP----TQLPETLLRLD 255
            .:.::.|.   ||..||:::..|..|...|  |..|:.|.:..|||...|    |.:..||..:.
  Fly   848 VEQFSNLR---KLRILRINSNRLRALPREVFMNTRLEFLDIAENQLSVWPVPAFTDIGFTLRSIQ 909

  Fly   256 ISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVL--ETLSFQNSRQLSHLDAEA 318
            :|.|.||.|   |.:..  :...|:.|:.:.:    |.:|   :|  .|.||.|:  |::||...
  Fly   910 MSHNNLEYL---DASMF--INSQFLYDISLAR----NRIT---ILPDNTFSFLNN--LTNLDLSQ 960

  Fly   319 FGPIMTTPTKK-----RALRSLSFRGTMLRTFNSTLAPIFTQLAELDLNGLPLQ 367
             .|::||..::     ..||.||.....|........|:   |:.||::|..||
  Fly   961 -NPLVTTNLREVFVHTPRLRKLSLHHMGLYVLPPLKLPL---LSYLDVSGNYLQ 1010

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 4/25 (16%)
LRR_8 108..167 CDD:290566 22/59 (37%)
leucine-rich repeat 109..132 CDD:275380 7/23 (30%)
LRR_RI <121..>261 CDD:238064 48/146 (33%)
leucine-rich repeat 133..156 CDD:275380 10/22 (45%)
leucine-rich repeat 157..180 CDD:275380 10/22 (45%)
leucine-rich repeat 181..208 CDD:275380 6/26 (23%)
leucine-rich repeat 230..253 CDD:275380 9/26 (35%)
leucine-rich repeat 254..274 CDD:275380 6/19 (32%)
leucine-rich repeat 275..299 CDD:275380 4/23 (17%)
leucine-rich repeat 300..319 CDD:275380 8/20 (40%)
CG4168NP_001285953.1 leucine-rich repeat 99..118 CDD:275380
LRR_8 121..181 CDD:290566
LRR_RI 122..350 CDD:238064
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
LRR_8 265..322 CDD:290566
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR_RI 315..546 CDD:238064
leucine-rich repeat 339..365 CDD:275380
LRR_8 365..424 CDD:290566
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
LRR_8 413..470 CDD:290566
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
LRR_8 482..545 CDD:290566
leucine-rich repeat 484..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..589 CDD:275380
LRR_RI 588..891 CDD:238064 54/175 (31%)
LRR_8 588..650 CDD:290566
leucine-rich repeat 590..613 CDD:275380
leucine-rich repeat 614..639 CDD:275380
LRR_8 638..698 CDD:290566
leucine-rich repeat 640..663 CDD:275380
leucine-rich repeat 664..687 CDD:275380
LRR_8 688..749 CDD:290566 8/27 (30%)
leucine-rich repeat 688..711 CDD:275380
leucine-rich repeat 712..735 CDD:275380 5/13 (38%)
leucine-rich repeat 740..783 CDD:275380 11/44 (25%)
LRR_8 784..843 CDD:290566 25/59 (42%)
leucine-rich repeat 785..808 CDD:275380 10/22 (45%)
leucine-rich repeat 809..832 CDD:275380 10/22 (45%)
LRR_RI <827..1053 CDD:238064 58/206 (28%)
LRR_8 832..890 CDD:290566 17/61 (28%)
leucine-rich repeat 833..856 CDD:275380 6/26 (23%)
leucine-rich repeat 857..879 CDD:275380 7/21 (33%)
leucine-rich repeat 880..900 CDD:275380 6/19 (32%)
LRR_8 904..963 CDD:290566 20/73 (27%)
leucine-rich repeat 905..928 CDD:275380 7/27 (26%)
leucine-rich repeat 929..952 CDD:275380 7/29 (24%)
leucine-rich repeat 953..977 CDD:275380 6/24 (25%)
leucine-rich repeat 978..1020 CDD:275380 12/36 (33%)
LRR_8 1019..1074 CDD:290566
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.