DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and Lingo4

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_796224.1 Gene:Lingo4 / 320747 MGIID:2444651 Length:618 Species:Mus musculus


Alignment Length:548 Identity:128/548 - (23%)
Similarity:194/548 - (35%) Gaps:203/548 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CECSNVSASPWGNRALRIDCSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLR 115
            |:|::.:.:        :.|:::  ::..:...|||..:.||||.|.|..               
Mouse    60 CDCTSQTRA--------VFCAHR--RLDTIPGGLPLDTELLDLSGNRLWG--------------- 99

  Fly   116 HNNISQLVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLV 180
                  |..|...:|..|:||.|.:|.:..||.|:|.||..|..|.|..|.|.::...:|:.|..
Mouse   100 ------LQRGMLSRLGQLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRLRIVGPGIFSGLTA 158

  Fly   181 LGTLDISWNR-------RFNESG-------GD---------LYTGLGVNWKLSTLRLDACSLNDL 222
            |..||:..|:       .|:|.|       ||         .:.||.   ||||:.|:.|:|:.:
Mouse   159 LTLLDLRLNQIVLFLDGAFSELGSLQQLEVGDNHLVFVAPGAFAGLA---KLSTITLERCNLSTV 220

  Fly   223 ------HLP--VNAPLKELSLRRNQLKRIPTQLPETLLRLDISDNLLEELLPEDTANLTQVRQLF 279
                  .||  |...|:||.:.|         ||...||                 .|.|:::|.
Mouse   221 PGLALAQLPALVALRLRELDIER---------LPAGALR-----------------GLGQLKELE 259

  Fly   280 IEDMPVLQRVVANSLTHVDV---------LETLSFQNSRQLSH---LDAEAFGPIMTTPTKK--- 329
            |...|.|:.:...||..:::         |.::.||....||.   ||... .||...|.::   
Mouse   260 IHHWPSLEALDPGSLVGLNLSSLAITRCNLSSVPFQALHHLSFLRILDLSQ-NPISAIPARRLSP 323

  Fly   330 --------------RALRSLSFRG-----------TMLRTFNSTLAPIFTQLAELDLNGLPLQCD 369
                          .::.:.:|.|           ..|:|...|..|...:|..|.|:|.||.||
Mouse   324 LVRLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKLVTLRLSGNPLTCD 388

  Fly   370 CELVWLKQL---------------PVQTNGR---------------CYKPARIR----------- 393
            |.|:||.:|               |....|:               | |||.||           
Mouse   389 CRLLWLLRLRRRLDFGTSPPACAGPQHVQGKSLREFSDILPPGHFTC-KPALIRKSGPRWVIAEE 452

  Fly   394 -GMLVTSARGDAFSCDT--W--PRWAY------------GLVVLSLIALSAAGIYLIVMGLRPHR 441
             |..|.|..||.....|  |  |:.|:            |.:.:..:.|...|.|:.|:.     
Mouse   453 GGHAVFSCSGDGDPAPTVSWMRPQGAWLGRVGRVRVLEDGTLEIRSVQLRDRGAYVCVVS----- 512

  Fly   442 GVTMRRKVGAGSPYARVTIEPNRQENPH 469
                  .| ||:...|..:|..:.|.|:
Mouse   513 ------NV-AGNDSLRTWLEVIQVEPPN 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 6/17 (35%)
LRR_8 108..167 CDD:290566 18/58 (31%)
leucine-rich repeat 109..132 CDD:275380 3/22 (14%)
LRR_RI <121..>261 CDD:238064 50/170 (29%)
leucine-rich repeat 133..156 CDD:275380 11/22 (50%)
leucine-rich repeat 157..180 CDD:275380 7/22 (32%)
leucine-rich repeat 181..208 CDD:275380 11/49 (22%)
leucine-rich repeat 230..253 CDD:275380 6/22 (27%)
leucine-rich repeat 254..274 CDD:275380 1/19 (5%)
leucine-rich repeat 275..299 CDD:275380 6/23 (26%)
leucine-rich repeat 300..319 CDD:275380 7/21 (33%)
Lingo4NP_796224.1 LRRNT 56..89 CDD:214470 6/38 (16%)
leucine-rich repeat 69..86 CDD:275380 3/18 (17%)
leucine-rich repeat 87..110 CDD:275380 9/43 (21%)
LRR_8 90..145 CDD:290566 24/75 (32%)
leucine-rich repeat 111..134 CDD:275380 11/22 (50%)
LRR_RI 112..345 CDD:238064 64/262 (24%)
LRR_8 134..193 CDD:290566 16/58 (28%)
leucine-rich repeat 135..158 CDD:275380 7/22 (32%)
leucine-rich repeat 159..182 CDD:275380 6/22 (27%)
LRR_8 182..237 CDD:290566 14/57 (25%)
leucine-rich repeat 183..206 CDD:275380 4/25 (16%)
leucine-rich repeat 207..230 CDD:275380 7/22 (32%)
leucine-rich repeat 231..254 CDD:275380 10/48 (21%)
leucine-rich repeat 255..302 CDD:275380 10/46 (22%)
LRR_8 278..334 CDD:290566 10/56 (18%)
leucine-rich repeat 303..326 CDD:275380 5/23 (22%)
LRR_8 326..385 CDD:290566 10/58 (17%)
leucine-rich repeat 327..350 CDD:275380 2/22 (9%)
leucine-rich repeat 351..369 CDD:275380 3/17 (18%)
leucine-rich repeat 375..387 CDD:275378 6/11 (55%)
IG_like 445..526 CDD:214653 18/92 (20%)
Ig 456..526 CDD:299845 17/81 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.