DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and Lrrc4c

DIOPT Version :10

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_848840.3 Gene:Lrrc4c / 241568 MGIID:2442636 Length:640 Species:Mus musculus


Alignment Length:428 Identity:101/428 - (23%)
Similarity:153/428 - (35%) Gaps:133/428 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTFALLLTQLLAAHVARAEVIDAEETDRFCYPESSKNSRRSCECSNVSASPWGNRALRIDCSYKD 74
            |...|.|..|:.|.:.||:...:                 .|.||        |:..::.|..|:
Mouse    27 LVVLLALQLLVVAGLVRAQTCPS-----------------VCSCS--------NQFSKVICVRKN 66

  Fly    75 YKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLRHNNISQLVSGNFKQLTSLRELYLG 139
                                   |..||...|.:...|||..|.|..:...:||.|..|..|.|.
Mouse    67 -----------------------LREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLS 108

  Fly   140 WNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDISWNRR----------FNE 194
            .|.|..:|.|:|:||.:|..|:|..|.|..:|...|..|..|..|   |.|.          || 
Mouse   109 RNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKEL---WLRNNPIESIPSYAFN- 169

  Fly   195 SGGDLYTGLGVNWKLSTL-RLDACSLNDL-HLPVNA-----PLKELSLRRNQLKRIPTQLPETLL 252
                         ::.:| |||...|..| ::...|     .|:.|:|....|:.||...|...|
Mouse   170 -------------RIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKL 221

  Fly   253 -RLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVLETLSFQNSRQLSHLDA 316
             .||:|.|.|..:.|.....|..:::|:     ::|       :.:.|:|..:|.|.:.|..:: 
Mouse   222 DELDLSGNHLSAIRPGSFQGLMHLQKLW-----MIQ-------SQIQVIERNAFDNLQSLVEIN- 273

  Fly   317 EAFGPIMTTPTKKRALRSLSFRGTMLRTFNSTLAP--IFTQLAELD---LNGLPLQCDCELVWLK 376
                                     |...|.||.|  :||.|..|:   |:..|..|:|:::||.
Mouse   274 -------------------------LAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLS 313

  Fly   377 -----QLPVQTN--GRCYKPARIRGMLVTSARGDAFSC 407
                 ..|..|.  .||..|..::|..:.....:.|:|
Mouse   314 WWIRDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTC 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 LRR <90..367 CDD:443914 76/299 (25%)
leucine-rich repeat 90..108 CDD:275380 4/17 (24%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
leucine-rich repeat 133..156 CDD:275380 10/22 (45%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
leucine-rich repeat 181..208 CDD:275380 6/36 (17%)
leucine-rich repeat 230..253 CDD:275380 8/23 (35%)
leucine-rich repeat 254..274 CDD:275380 7/19 (37%)
leucine-rich repeat 275..299 CDD:275380 2/23 (9%)
leucine-rich repeat 300..319 CDD:275380 4/18 (22%)
Lrrc4cNP_848840.3 LRRNT 47..80 CDD:214470 10/80 (13%)
LRR <76..325 CDD:443914 77/303 (25%)
LRR 1 77..98 6/20 (30%)
leucine-rich repeat 78..101 CDD:275380 8/22 (36%)
LRR 2 101..122 8/20 (40%)
leucine-rich repeat 102..125 CDD:275380 10/22 (45%)
LRR 3 125..146 7/20 (35%)
leucine-rich repeat 126..149 CDD:275380 8/22 (36%)
LRR 4 149..170 6/37 (16%)
leucine-rich repeat 150..173 CDD:275380 6/39 (15%)
LRR 5 173..195 7/21 (33%)
leucine-rich repeat 174..198 CDD:275380 7/23 (30%)
LRR 6 198..219 7/20 (35%)
leucine-rich repeat 199..220 CDD:275380 7/20 (35%)
LRR 7 220..241 7/20 (35%)
leucine-rich repeat 221..244 CDD:275380 8/22 (36%)
LRR 8 244..265 5/32 (16%)
leucine-rich repeat 245..268 CDD:275380 6/34 (18%)
LRR 9 268..289 7/46 (15%)
leucine-rich repeat 269..290 CDD:275380 8/46 (17%)
IG_like 360..443 CDD:214653
Ig strand B 371..375 CDD:409390
Ig strand C 383..387 CDD:409390
Ig strand E 409..413 CDD:409390
Ig strand F 423..428 CDD:409390
Ig strand G 436..439 CDD:409390
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 463..482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.