DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and lron-5

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_497943.2 Gene:lron-5 / 184307 WormBaseID:WBGene00008656 Length:656 Species:Caenorhabditis elegans


Alignment Length:371 Identity:85/371 - (22%)
Similarity:122/371 - (32%) Gaps:113/371 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VSASPWGNRALRIDCSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNLRHNNIS 120
            |....|..|..|:    |...::...  |||:.|    :|.|       ....||.|::......
 Worm   250 VGFEEWLERKSRV----KSLNISHCQ--LPLHED----TWTA-------CGQFLHSLDISGIGAK 297

  Fly   121 QLVSGNFKQLTSLRELYLGWNSIGK------------LESGSFDGLP---------HLQVLDLAH 164
            :|   .|.:...:|.::...|.|..            ||...|...|         .|..|.|:|
 Worm   298 RL---RFSRFCPIRSVFARDNLISSVYIDAVSMESLHLERNMFSEFPIPPPGVELTELHTLGLSH 359

  Fly   165 NNLHLLPGHLFAPLLVLGTLDISWNRRFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPVNAP 229
            |.:..||.|.......|...|:|.| :.:|.....:..:|:.                       
 Worm   360 NLMTSLPPHALQSYPNLQHFDVSSN-QLSEIDPQAFPSIGLG----------------------- 400

  Fly   230 LKELSLRRNQLKRIPTQLPETLLRLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANS- 293
            |..|.|..|||..:|..:..:||.||:|.|.:..|.|.....|..::||.|...|.|.....|. 
 Worm   401 LISLDLSSNQLSSLPHPILPSLLLLDLSFNTISHLDPHFFTGLPMLQQLRIASNPTLFSRCPNRD 465

  Fly   294 ----LTHVDVLETL--------SFQNSRQLSHLDAEAFGPIMTTPTKKRALRSLSFRGTMLRTFN 346
                ..|:|.|.:|        ..:.|....||               |.|:||..||..:|..:
 Worm   466 SPCWSDHLDELTSLVDLDISNSGLEFSLHWRHL---------------RTLKSLILRGNEIRIID 515

  Fly   347 STLAP-------------IFT-------QLAELDLNGLPLQCDCEL 372
            |...|             .||       .|.:|.::..||:|||.|
 Worm   516 SKSLPENLRTLDLGENRVQFTSNFSKLEHLRDLRVDQNPLRCDCSL 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 2/17 (12%)
LRR_8 108..167 CDD:290566 17/79 (22%)
leucine-rich repeat 109..132 CDD:275380 5/22 (23%)
LRR_RI <121..>261 CDD:238064 36/160 (23%)
leucine-rich repeat 133..156 CDD:275380 7/43 (16%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
leucine-rich repeat 181..208 CDD:275380 6/26 (23%)
leucine-rich repeat 230..253 CDD:275380 8/22 (36%)
leucine-rich repeat 254..274 CDD:275380 7/19 (37%)
leucine-rich repeat 275..299 CDD:275380 7/28 (25%)
leucine-rich repeat 300..319 CDD:275380 5/26 (19%)
lron-5NP_497943.2 leucine-rich repeat 51..72 CDD:275380
LRR_8 72..131 CDD:338972
leucine-rich repeat 73..96 CDD:275380
LRR <92..>272 CDD:227223 5/27 (19%)
leucine-rich repeat 97..120 CDD:275380
leucine-rich repeat 121..146 CDD:275380
leucine-rich repeat 147..168 CDD:275380
leucine-rich repeat 169..208 CDD:275380
leucine-rich repeat 209..237 CDD:275380
leucine-rich repeat 238..284 CDD:275380 11/50 (22%)
leucine-rich repeat 327..351 CDD:275380 4/23 (17%)
internalin_A 345..>576 CDD:380193 62/256 (24%)
leucine-rich repeat 352..375 CDD:275380 8/22 (36%)
leucine-rich repeat 376..391 CDD:275380 5/15 (33%)
leucine-rich repeat 401..445 CDD:275380 16/43 (37%)
leucine-rich repeat 446..478 CDD:275380 9/31 (29%)
leucine-rich repeat 479..500 CDD:275380 4/35 (11%)
leucine-rich repeat 501..522 CDD:275380 8/20 (40%)
leucine-rich repeat 523..544 CDD:275380 2/20 (10%)
LRRCT 553..601 CDD:214507 6/9 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.