DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and sym-1

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_510426.1 Gene:sym-1 / 181555 WormBaseID:WBGene00006366 Length:680 Species:Caenorhabditis elegans


Alignment Length:373 Identity:89/373 - (23%)
Similarity:147/373 - (39%) Gaps:85/373 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SCECS---NVSASPWGNRALRID----CSYKDYKVADLSLLLPLYIDSLDLSWNALDSVP---IF 104
            |.:|:   |::...:.|....||    |:......||....:.:.:.:|.|..|.:...|   :.
 Worm   138 SLKCNKIENITTKAFVNMTSLIDVNLGCNQICSMAADTFANVKMSLQNLILDNNCMTEFPSKAVR 202

  Fly   105 TSDSLHQLNLRHNNISQLVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHL 169
            ..::|..|::::|.|:.:...:|..||||..|.|..|:|.:::.|:....|:|..|.|..|||..
 Worm   203 NMNNLIALHIKYNKINAIRQNDFVNLTSLSMLSLNGNNISEIKGGALQNTPNLHYLYLNENNLQT 267

  Fly   170 LPGHLFAPLLVLGTLDISWNRRFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPVNAPLKELS 234
            |...:......|..||:|:| .|.:...:::.||                        ..::.|:
 Worm   268 LDNGVLEQFKQLQVLDLSFN-NFTDITKEMFEGL------------------------ESIQHLN 307

  Fly   235 LRRNQLKRI-PTQLPET-LLRLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHV 297
            |..|::..: |.....| ||.|.:.:|.           ||:|.|..::..|.| |:|:.|..::
 Worm   308 LDSNRISAVAPGAFAGTPLLLLWLPNNC-----------LTEVSQQTLKGAPFL-RMVSLSNNNI 360

  Fly   298 DVLETLSFQNSRQLSHLDAEAFGPIMTTPTKKRALRSLSFRGTMLRTFNSTLAP--IFTQLAELD 360
            ..:..|||.:...|..||. |...||:...|     |||             .|  :..:|.|..
 Worm   361 REVHELSFDHLPNLHTLDL-ANNKIMSLQNK-----SLS-------------GPENLAVRLQENP 406

  Fly   361 L----NGLPLQCDCELVWLK---------QLPVQTNGRCYK--PARIR 393
            :    ||..:....|.:||.         :...||...|.|  |..||
 Worm   407 VVCVKNGFHVLNSGEAIWLTNEANTICKGEWQAQTADLCPKAQPRPIR 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 4/20 (20%)
LRR_8 108..167 CDD:290566 19/58 (33%)
leucine-rich repeat 109..132 CDD:275380 6/22 (27%)
LRR_RI <121..>261 CDD:238064 35/141 (25%)
leucine-rich repeat 133..156 CDD:275380 6/22 (27%)
leucine-rich repeat 157..180 CDD:275380 7/22 (32%)
leucine-rich repeat 181..208 CDD:275380 8/26 (31%)
leucine-rich repeat 230..253 CDD:275380 6/24 (25%)
leucine-rich repeat 254..274 CDD:275380 3/19 (16%)
leucine-rich repeat 275..299 CDD:275380 7/23 (30%)
leucine-rich repeat 300..319 CDD:275380 6/18 (33%)
sym-1NP_510426.1 leucine-rich repeat 62..81 CDD:275380
LRR_5 74..208 CDD:290045 13/69 (19%)
LRR_RI 81..384 CDD:238064 68/283 (24%)
leucine-rich repeat 86..108 CDD:275380
leucine-rich repeat 110..133 CDD:275380
leucine-rich repeat 134..157 CDD:275380 4/18 (22%)
leucine-rich repeat 158..182 CDD:275380 5/23 (22%)
LRR_8 182..241 CDD:290566 16/58 (28%)
leucine-rich repeat 183..206 CDD:275380 4/22 (18%)
leucine-rich repeat 207..230 CDD:275380 6/22 (27%)
leucine-rich repeat 231..254 CDD:275380 6/22 (27%)
LRR_8 253..313 CDD:290566 19/84 (23%)
leucine-rich repeat 255..278 CDD:275380 7/22 (32%)
leucine-rich repeat 279..302 CDD:275380 8/47 (17%)
LRR_8 302..384 CDD:290566 25/94 (27%)
leucine-rich repeat 303..323 CDD:275380 4/19 (21%)
leucine-rich repeat 350..373 CDD:275380 7/23 (30%)
leucine-rich repeat 374..394 CDD:275380 10/38 (26%)
leucine-rich repeat 399..410 CDD:275378 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.