DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and egg-6

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_492348.1 Gene:egg-6 / 172670 WormBaseID:WBGene00010621 Length:961 Species:Caenorhabditis elegans


Alignment Length:377 Identity:93/377 - (24%)
Similarity:150/377 - (39%) Gaps:92/377 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LRID----CSY--KDYKVADLSLLLPLYIDSLDLSWNALDSVP---IFTSDSLHQLNLRHNNISQ 121
            ||::    |.:  |.......||:|      ||:|.|.||::|   :..:.:|..|:|..||||:
 Worm   155 LRLENNAICDFPPKSLDAVKASLVL------LDVSGNCLDAIPAQILRNAANLMYLDLGSNNISE 213

  Fly   122 LVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLLVLGTLDI 186
            :.:.....|..||||.:..|::.::...:|..:|.||.|.|..|.:..|.|:.......|..||:
 Worm   214 INNFELMNLPFLRELRVQNNTLRRIHPMAFMNVPQLQYLYLQDNIISTLDGNRLQGFKNLEVLDV 278

  Fly   187 SWNRRFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPVNAPLKELSLRRNQLKRIPTQLPETL 251
            |.|.        ||.              ..||.||     ..||::.:..|.:.:|.|      
 Worm   279 SNNA--------LYA--------------LPSLKDL-----PNLKQVRVDGNLITKIET------ 310

  Fly   252 LRLDISDNLLEELLPEDTANLTQVRQLFIE--DMPVLQRVVANSLTHVD--------VLETLSFQ 306
              |..|:|...:|:.....|:.|:.:...|  |..|:..|..|||..::        .|:.||.:
 Worm   311 --LAFSNNPNLQLISVQNNNIVQISRNSFESLDKLVVLLVGNNSLAKIERGMFDGMKNLQQLSIR 373

  Fly   307 NSRQLSHLDAEAFGPIMTTPT-----------------KKRALRSLSFRGTMLRTFNSTLAPIF- 353
            |: .|:.|||.:|..:....|                 |...|..|......:..|.::   :| 
 Worm   374 NN-TLTALDASSFAQLAHLTTLDLGHNKIHDIEEGTFDKLSKLFWLDLSNNKISGFKTS---VFK 434

  Fly   354 TQLAELDLNGLPLQCDCE----LVWL------KQLPVQTNGRCYKPARIRGM 395
            .:::.:.|:|..|.||..    |.:|      ..||.|....|:.|.:..|:
 Worm   435 KKISNILLDGNQLICDESFNEFLTYLIANKVRTFLPFQQEIMCHGPEKYAGV 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 7/20 (35%)
LRR_8 108..167 CDD:290566 20/58 (34%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
LRR_RI <121..>261 CDD:238064 34/139 (24%)
leucine-rich repeat 133..156 CDD:275380 6/22 (27%)
leucine-rich repeat 157..180 CDD:275380 7/22 (32%)
leucine-rich repeat 181..208 CDD:275380 7/26 (27%)
leucine-rich repeat 230..253 CDD:275380 5/22 (23%)
leucine-rich repeat 254..274 CDD:275380 5/19 (26%)
leucine-rich repeat 275..299 CDD:275380 7/33 (21%)
leucine-rich repeat 300..319 CDD:275380 8/18 (44%)
egg-6NP_492348.1 LRR_8 107..162 CDD:290566 2/6 (33%)
leucine-rich repeat 107..127 CDD:275380
leucine-rich repeat 128..151 CDD:275380
LRR_RI <144..281 CDD:238064 40/131 (31%)
leucine-rich repeat 152..200 CDD:275380 14/50 (28%)
LRR_8 176..233 CDD:290566 22/62 (35%)
leucine-rich repeat 201..224 CDD:275380 8/22 (36%)
LRR_8 225..283 CDD:290566 19/65 (29%)
leucine-rich repeat 225..248 CDD:275380 6/22 (27%)
LRR_RI <240..458 CDD:238064 58/256 (23%)
leucine-rich repeat 249..272 CDD:275380 7/22 (32%)
LRR_8 271..329 CDD:290566 20/92 (22%)
leucine-rich repeat 273..294 CDD:275380 11/47 (23%)
leucine-rich repeat 295..318 CDD:275380 8/30 (27%)
LRR_8 317..375 CDD:290566 13/57 (23%)
leucine-rich repeat 319..342 CDD:275380 4/22 (18%)
leucine-rich repeat 343..366 CDD:275380 5/22 (23%)
LRR_8 365..425 CDD:290566 13/60 (22%)
leucine-rich repeat 367..390 CDD:275380 9/23 (39%)
leucine-rich repeat 391..414 CDD:275380 2/22 (9%)
leucine-rich repeat 415..434 CDD:275380 3/21 (14%)
leucine-rich repeat 437..449 CDD:275378 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.