DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and lrrc4bb

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_003201401.1 Gene:lrrc4bb / 100535350 ZFINID:ZDB-GENE-091116-44 Length:726 Species:Danio rerio


Alignment Length:394 Identity:98/394 - (24%)
Similarity:148/394 - (37%) Gaps:112/394 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ESSKNSRRSCECSNVSASPWGNRALRIDCSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTS 106
            |:|......|.||        |:|.|:.|:.|                       :|:.||...|
Zfish    34 EASPACPALCSCS--------NQASRVICTKK-----------------------SLNEVPQSIS 67

  Fly   107 DSLHQLNLRHNNISQLVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLP 171
            .:...|||:.|:|..:.|..||.|..|..|.|..|.|.::|.|:|:|||:|..|:|..|.|.|:|
Zfish    68 SNTRYLNLQENSIQVIRSDTFKHLNHLEILQLSKNQIRQIEVGAFNGLPNLITLELFDNRLPLVP 132

  Fly   172 GHLFAPLLVLGTLDISWNRRFNESGGDLYTGLGVNWKLSTL------------RLDACSLNDLHL 224
            ...|..|..|..|   |.|               |..:.||            |||...|..|..
Zfish   133 SQAFEYLSKLREL---WLR---------------NNPIETLPAYAFHRVPSLRRLDLGELRKLSF 179

  Fly   225 PVNAP------LKELSLRRNQLKRIPTQLPETLL-RLDISDNLLEELLPEDTANLTQVRQLFI-- 280
            ...|.      |:.|:|....||.:|...|...| .|::|.|.|..:.|.....|..:|:|::  
Zfish   180 ISEAAFEGLLNLRFLNLGMCGLKDVPNLTPLVRLEELELSGNQLGVVRPGSFQGLVSLRKLWLMH 244

  Fly   281 EDMPVLQRVVANSLTHVDVLETLSFQNSRQLSHLDAEAFGPIMTTPTKKRALRSLSFRGTMLRTF 345
            ..:.|::|...:.|.:::.| .||..:...|.|   :.|.|:.                      
Zfish   245 SRISVIERNAFDDLKNLEEL-NLSHNSLHSLPH---DLFTPLQ---------------------- 283

  Fly   346 NSTLAPIFTQLAELDLNGLPLQCDCELVWL-----KQLPVQTN--GRCYKPARIRGMLVTSARGD 403
                     ||..:.||..|..|:|:::||     :.:|..:.  .||:.|...:|..:......
Zfish   284 ---------QLERVHLNHNPWVCNCDVLWLSWWLKETVPDNSTCCARCHAPPGTKGRYIGDLDQR 339

  Fly   404 AFSC 407
            .|:|
Zfish   340 DFTC 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 4/17 (24%)
LRR_8 108..167 CDD:290566 24/58 (41%)
leucine-rich repeat 109..132 CDD:275380 9/22 (41%)
LRR_RI <121..>261 CDD:238064 48/158 (30%)
leucine-rich repeat 133..156 CDD:275380 10/22 (45%)
leucine-rich repeat 157..180 CDD:275380 9/22 (41%)
leucine-rich repeat 181..208 CDD:275380 5/26 (19%)
leucine-rich repeat 230..253 CDD:275380 8/23 (35%)
leucine-rich repeat 254..274 CDD:275380 6/19 (32%)
leucine-rich repeat 275..299 CDD:275380 5/25 (20%)
leucine-rich repeat 300..319 CDD:275380 5/18 (28%)
lrrc4bbXP_003201401.1 LRRNT 38..72 CDD:214470 12/64 (19%)
LRR_8 68..128 CDD:290566 24/59 (41%)
leucine-rich repeat 70..93 CDD:275380 9/22 (41%)
LRR_RI 85..293 CDD:238064 67/260 (26%)
leucine-rich repeat 94..117 CDD:275380 10/22 (45%)
leucine-rich repeat 118..141 CDD:275380 9/22 (41%)
LRR_8 140..196 CDD:290566 15/73 (21%)
leucine-rich repeat 142..165 CDD:275380 7/40 (18%)
leucine-rich repeat 166..190 CDD:275380 6/23 (26%)
leucine-rich repeat 191..212 CDD:275380 7/20 (35%)
LRR_8 212..271 CDD:290566 15/59 (25%)
leucine-rich repeat 213..236 CDD:275380 7/22 (32%)
leucine-rich repeat 237..260 CDD:275380 5/22 (23%)
leucine-rich repeat 261..282 CDD:275380 6/24 (25%)
TPKR_C2 293..343 CDD:301599 11/49 (22%)
IG_like 352..435 CDD:214653
Ig 360..435 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.