DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4781 and lrrc4b

DIOPT Version :9

Sequence 1:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001096358.1 Gene:lrrc4b / 100124949 XenbaseID:XB-GENE-5945982 Length:641 Species:Xenopus tropicalis


Alignment Length:376 Identity:99/376 - (26%)
Similarity:145/376 - (38%) Gaps:92/376 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SCECSNVSASPWGNRALRIDCSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPIFTSDSLHQLNL 114
            :|.||        |:|.|:.|:.::                       |..||...|.:...|||
 Frog    45 ACTCS--------NQASRVACTRRE-----------------------LMEVPESISVNTRYLNL 78

  Fly   115 RHNNISQLVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHLLPGHLFAPLL 179
            :.|.|..:.:..||.|..|..|.|..|.|.|:|.|:|:|||:|..|:|..|.|..:|...|..|.
 Frog    79 QENIIQVIKTDTFKHLRHLEILQLSKNLIRKIEVGAFNGLPNLSTLELFDNRLTTVPTQAFEYLS 143

  Fly   180 VLGTLDISWNRRFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPVNAP------LKELSLRRN 238
            .|..|   |.|   .:..:.......|...|..|||...|..|.....|.      |:.|:|...
 Frog   144 KLREL---WLR---NNPIESIPSYAFNRVPSLRRLDLGELKKLEYISEAAFEGLVNLRYLNLGMC 202

  Fly   239 QLKRIP--TQLPETLLRLDISDNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVLE 301
            .||.||  |.|.. |..|::|.|.||.:.|.....||.:|:|::..            .||.::|
 Frog   203 NLKDIPNLTALVR-LEELELSGNRLEMIRPGSFQGLTSLRKLWLMH------------AHVTIIE 254

  Fly   302 TLSFQNSRQLSHLDAEAFGPIMTTPTKKRALRSLSFRGTMLRTFNSTLAPIFTQLAELD---LNG 363
            ..:|.:.:.|..|                   :||....|     |....:||.|..|:   ||.
 Frog   255 RNAFDDLKSLEEL-------------------NLSHNNLM-----SLPHDLFTPLHRLERVHLNH 295

  Fly   364 LPLQCDCELVWL-----KQLPVQTN--GRCYKPARIRGMLVTSARGDAFSC 407
            .|..|:|:::||     :.:|..|.  .||:.|..::...:.......|:|
 Frog   296 NPWHCNCDVLWLSWWLKETVPNNTTCCARCHSPPNLKMRYIGELDQSHFTC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 4/17 (24%)
LRR_8 108..167 CDD:290566 24/58 (41%)
leucine-rich repeat 109..132 CDD:275380 8/22 (36%)
LRR_RI <121..>261 CDD:238064 48/147 (33%)
leucine-rich repeat 133..156 CDD:275380 11/22 (50%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
leucine-rich repeat 181..208 CDD:275380 5/26 (19%)
leucine-rich repeat 230..253 CDD:275380 10/24 (42%)
leucine-rich repeat 254..274 CDD:275380 7/19 (37%)
leucine-rich repeat 275..299 CDD:275380 4/23 (17%)
leucine-rich repeat 300..319 CDD:275380 4/18 (22%)
lrrc4bNP_001096358.1 LRRNT 42..75 CDD:214470 11/60 (18%)
leucine-rich repeat 73..96 CDD:275380 8/22 (36%)
leucine-rich repeat 97..120 CDD:275380 11/22 (50%)
PPP1R42 100..297 CDD:411060 67/239 (28%)
leucine-rich repeat 121..144 CDD:275380 8/22 (36%)
leucine-rich repeat 145..168 CDD:275380 5/28 (18%)
leucine-rich repeat 169..193 CDD:275380 6/23 (26%)
leucine-rich repeat 194..215 CDD:275380 9/20 (45%)
leucine-rich repeat 216..239 CDD:275380 8/22 (36%)
leucine-rich repeat 240..263 CDD:275380 6/34 (18%)
leucine-rich repeat 264..285 CDD:275380 8/44 (18%)
LRRCT 296..346 CDD:214507 11/49 (22%)
I-set 349..438 CDD:400151
Ig strand A 349..352 CDD:409353
Ig strand A' 356..359 CDD:409353
Ig strand B 365..372 CDD:409353
Ig strand C 378..383 CDD:409353
Ig strand C' 386..388 CDD:409353
Ig strand D 397..401 CDD:409353
Ig strand E 404..408 CDD:409353
Ig strand F 418..425 CDD:409353
Ig strand G 428..438 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.