DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and PRY2

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:23/116 - (19%)
Similarity:45/116 - (38%) Gaps:30/116 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NTRRFKH--VGQLT-------------------GHVIFSAGKHSDLELLRH----KISNWFGQYM 161
            ||:|..|  .|.||                   |:::.|.|.:.:...|.:    .:..|:.:. 
Yeast   201 NTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGYGTTGSVDAWYNEI- 264

  Fly   162 RASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCNF 212
             .|.|......|.:...|.|::.:.::.:|||:......  | ..:|:|::
Yeast   265 -TSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGE--W-GDYIICSY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 23/116 (20%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 23/116 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344561
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.