DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and PRY3

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:43/220 - (19%)
Similarity:70/220 - (31%) Gaps:88/220 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FSIRVWFICLVIV-TLNSFPAYSWDYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQ 65
            |.|.|...|||.| ...:||.:..|...||                               |:.:
Yeast     4 FPISVLLGCLVAVKAQTTFPNFESDVLNEH-------------------------------NKFR 37

  Fly    66 AFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKR--CSLSGDGCRNTRRFKH 128
            |..|.                      .|.:.|...||..|:..|.:  ||              
Yeast    38 ALHVD----------------------TAPLTWSDTLATYAQNYADQYDCS-------------- 66

  Fly   129 VGQLTGHVIFSAGKHSDLELLRH----KISNWFGQYMRASKDLQAADP--SSNISSFRQLIQESS 187
             |.||    .|.|.:.:...|.:    .:..|:|:..:    ...::|  |.:...|.|::.:|:
Yeast    67 -GVLT----HSDGPYGENLALGYTDTGAVDAWYGEISK----YNYSNPGFSESTGHFTQVVWKST 122

  Fly   188 THMGCGVLRQRSHMLWHQQFIVCNF 212
            ..:|||.  :.....|: .:|||::
Yeast   123 AEIGCGY--KYCGTTWN-NYIVCSY 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 30/156 (19%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 34/200 (17%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344582
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.