DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and PRY1

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:122 Identity:24/122 - (19%)
Similarity:48/122 - (39%) Gaps:26/122 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 SVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRH----KISN 155
            ::.|...||..|:..|.....||.                 :..|.|.:.:...|.:    .:..
Yeast   182 ALSWSDTLASYAQDYADNYDCSGT-----------------LTHSGGPYGENLALGYDGPAAVDA 229

  Fly   156 WFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCNF 212
            |:.:.  ::.|......|||...|.|::.:|:|.:|||:  :.....| ..:::|::
Yeast   230 WYNEI--SNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGI--KTCGGAW-GDYVICSY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 24/122 (20%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 24/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344540
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.