DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CRISPLD2

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:239 Identity:52/239 - (21%)
Similarity:92/239 - (38%) Gaps:66/239 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 REARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSG 117
            |..|.||..::.:..::|  |..|.||..       .|..|..:.||.||.:.|...|.:|.   
Human    46 RVRRAIPREDKEEILMLH--NKLRGQVQP-------QASNMEYMTWDDELEKSAAAWASQCI--- 98

  Fly   118 DGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRHK-----ISNWFGQYMRASKDLQAADPSS--- 174
                    ::| |..:  ::.|.|::......|::     :.:|:.:.    ||.....||.   
Human    99 --------WEH-GPTS--LLVSIGQNLGAHWGRYRSPGFHVQSWYDEV----KDYTYPYPSECNP 148

  Fly   175 ---------NISSFRQLIQESSTHMGCGVLRQRSHMLW-----HQQFIVCNFA-RRNMPREQVYQ 224
                     ..:.:.|::..::..:||.|...|...:|     :..:.|||:: :.|...|..|:
Human   149 WCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYK 213

  Fly   225 VGVAATGC-----RSGRNPRYPNLCALQEEY-------DVNAVD 256
            .|...:.|     .|.||    |||..:|.|       ::|.|:
Human   214 NGRPCSECPPSYGGSCRN----NLCYREETYTPKPETDEMNEVE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 33/169 (20%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 33/171 (19%)
LCCL 286..370 CDD:128866
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151222
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.