DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and Crispld1

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:245 Identity:50/245 - (20%)
Similarity:89/245 - (36%) Gaps:84/245 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NQLQAFI-VHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRR 125
            |.:|:.: :|  |..|:||       :..|..|..:.||.||.:.||..|:.|            
Mouse    60 NDMQSILDLH--NKLRSQV-------YPTASNMEYMTWDVELERSAESWAEMC------------ 103

  Fly   126 FKHVGQLTGHVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQA---------------ADP--- 172
                       ::..|..|.|..:...:...:|:|...:..:||               .||   
Mouse   104 -----------LWEHGPASLLPSIGQNLGAHWGRYRPPTFHVQAWYDEVRDFSYPYENECDPYCP 157

  Fly   173 ---SSNI-SSFRQLIQESSTHMGCGVLRQRSHMLWHQ-----QFIVCNFA-RRNMPREQVYQVGV 227
               |..: :.:.|::..:|:.:||.|....:..:|.|     .::|||:: :.|......|:.|.
Mouse   158 FRCSGPVCTHYTQVVWATSSRIGCAVNLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGR 222

  Fly   228 AAT--------GCRSGRNPRYPNLCALQ--------EEYDVNAVDRFHSK 261
            ..:        |||.       |||..:        .|.:.|.::|..|:
Mouse   223 PCSACPPSFGGGCRE-------NLCYKEGSDRYYTPREEETNEIERQQSQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 36/175 (21%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 36/176 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281 2/8 (25%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841236
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.