DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and CRISPLD1

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:266 Identity:49/266 - (18%)
Similarity:95/266 - (35%) Gaps:81/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NQLQAFI-VHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRR 125
            |.:|:.: :|  |..|:||       :..|..|..:.||.||.:.||..|:.|            
Human    60 NDMQSILDLH--NKLRSQV-------YPTASNMEYMTWDVELERSAESWAESC------------ 103

  Fly   126 FKHVGQLTGHVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQA-ADPSSNIS------------ 177
                       ::..|..|.|..:...:...:|:|...:..:|: .|...:.|            
Human   104 -----------LWEHGPASLLPSIGQNLGAHWGRYRPPTFHVQSWYDEVKDFSYPYEHECNPYCP 157

  Fly   178 ---------SFRQLIQESSTHMGCGVLRQRSHMLWHQ-----QFIVCNFA-RRNMPREQVYQVGV 227
                     .:.|::..:|..:||.:....:..:|.|     .::|||:: :.|......|:.|.
Human   158 FRCSGPVCTHYTQVVWATSNRIGCAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGR 222

  Fly   228 AATGC--------------RSGRNPRYPNLCALQEEYDVNAVDRFHSK-RPLRIRFKYSASHPSK 277
            ..:.|              :.|.:..||     ..|.:.|.::|..|: ....:|.:...|..::
Human   223 PCSACPPSFGGGCRENLCYKEGSDRYYP-----PREEETNEIERQQSQVHDTHVRTRSDDSSRNE 282

  Fly   278 VLGADR 283
            |:.|.:
Human   283 VISAQQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 33/175 (19%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180 33/175 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281 5/26 (19%)
LCCL 291..375 CDD:128866
LCCL 392..483 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.