DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and AT5G66590

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_201460.1 Gene:AT5G66590 / 836791 AraportID:AT5G66590 Length:185 Species:Arabidopsis thaliana


Alignment Length:132 Identity:26/132 - (19%)
Similarity:43/132 - (32%) Gaps:52/132 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 AFGPARRMASVRWDPEL--AQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLEL 148
            |...||.|..|   |.|  :|..|.||.|.:          |::...:.......:.||:...:|
plant    52 AHNKARAMVGV---PPLVWSQTLEAAASRLA----------RYQRNQKKCEFASLNPGKYGANQL 103

  Fly   149 LRHKISNWFGQYMRASKDLQAADPSSNISS-----------------------FRQLIQESSTHM 190
                   |       :|.|.|..||..:.:                       ::|::..:|..:
plant   104 -------W-------AKGLVAVTPSLAVETWVKEKPFYNYKSDTCAANHTCGVYKQVVWRNSKEL 154

  Fly   191 GC 192
            ||
plant   155 GC 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 26/132 (20%)
AT5G66590NP_201460.1 CAP_PR-1 46..185 CDD:349400 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.