powered by:
Protein Alignment CG3640 and AT5G26130
DIOPT Version :9
Sequence 1: | NP_611950.1 |
Gene: | CG3640 / 37942 |
FlyBaseID: | FBgn0035042 |
Length: | 296 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_197985.2 |
Gene: | AT5G26130 / 832682 |
AraportID: | AT5G26130 |
Length: | 166 |
Species: | Arabidopsis thaliana |
Alignment Length: | 137 |
Identity: | 29/137 - (21%) |
Similarity: | 42/137 - (30%) |
Gaps: | 58/137 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 YSWDYCQEHWCPRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFIVHQVNFYRNQVASGGLSA 86
|:|:|.|:.....|..| .|:||.:| .|...|||..:
plant 59 YAWNYAQQRKGDCSLTH--SNSNGLYG---------------------------ENLAWSGGALS 94
Fly 87 FGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRH 151
...|.:: |..|.:... .|:..|| || |..|..| .|::
plant 95 GAEAVKL----WVNEKSDYI-YASNTCS---DG-------KQCGHYT-QVVW------------- 130
Fly 152 KISNWFG 158
:.|.|.|
plant 131 RTSEWVG 137
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.