DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and AT5G02730

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_195893.1 Gene:AT5G02730 / 831820 AraportID:AT5G02730 Length:205 Species:Arabidopsis thaliana


Alignment Length:142 Identity:32/142 - (22%)
Similarity:60/142 - (42%) Gaps:16/142 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RNQVASGGLSAFGPAR---RMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVI 137
            ||:.::..|.|...||   ..:::|||..||:.|...||:   ....|:.|    |.|...|..|
plant    53 RNKQSAEFLLAHNAARVASGASNLRWDQGLARFASKWAKQ---RKSDCKMT----HSGGPYGENI 110

  Fly   138 FSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQRSHML 202
            |.. :.|:....|..:..|..:.:...:........:....:.|::..::|.:||.    ||...
plant   111 FRY-QRSENWSPRRVVDKWMDESLNYDRVANTCKSGAMCGHYTQIVWRTTTAVGCA----RSKCD 170

  Fly   203 WHQQF-IVCNFA 213
            .::.| ::|.::
plant   171 NNRGFLVICEYS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 32/140 (23%)
AT5G02730NP_195893.1 SCP_PR-1_like 57..193 CDD:240181 30/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.