DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and AT4G30320

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 / 829155 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana


Alignment Length:129 Identity:25/129 - (19%)
Similarity:53/129 - (41%) Gaps:29/129 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 RMASVRWDPELAQLAELAAKR----CSLS-GDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRH 151
            |:..::||.:||:.|:..|.:    |:|: .:|......|...|...|....:.|..|:.....:
plant    42 RLKPLKWDAKLARYAQWWANQRRGDCALTHSNGPYGENLFWGSGNRWGPSQAAYGWLSEARSYNY 106

  Fly   152 KISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQRSHMLWH---QQFIVCNF 212
            : ||              :..|.....:.|::.:::..:||      :|::.:   ..|:.||:
plant   107 R-SN--------------SCNSEMCGHYTQIVWKNTQKIGC------AHVICNGGGGVFLTCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 25/129 (19%)
AT4G30320NP_194761.1 CAP_PR-1 27..161 CDD:349400 25/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.