DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and AT3G19690

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:159 Identity:33/159 - (20%)
Similarity:55/159 - (34%) Gaps:36/159 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LSNQLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKR----CSLSGDGC 120
            |:..||...:...|..||:|   ||.         .:.||.|:|..|...|.:    |:|.... 
plant    21 LAEDLQQQFLEAHNEARNEV---GLD---------PLVWDDEVAAYAASYANQRINDCALVHSN- 72

  Fly   121 RNTRRFKHVGQLTGHVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQAA-DPSSNIS-SFRQLI 183
                     |....::..|:|:.|    .......|..:......|.... ||:.... .:.|::
plant    73 ---------GPFGENIAMSSGEMS----AEDAAEMWINEKQYYDYDSNTCNDPNGGTCLHYTQVV 124

  Fly   184 QESSTHMGCGVLRQRSHMLWHQQFIVCNF 212
            .:::..:||..:...|    ...||.||:
plant   125 WKNTVRLGCAKVVCNS----GGTFITCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 31/154 (20%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 31/154 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.