DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and AT3G09590

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_187570.1 Gene:AT3G09590 / 820116 AraportID:AT3G09590 Length:186 Species:Arabidopsis thaliana


Alignment Length:224 Identity:41/224 - (18%)
Similarity:66/224 - (29%) Gaps:97/224 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ARLIPLSNQ-LQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKR----CS 114
            ||...||.: |||        :.:...|.|:...|         ||.:||:.|:..||:    ||
plant    44 ARRAKLSREFLQA--------HNDARVSSGVPTLG---------WDRDLARFADKWAKQRKSDCS 91

  Fly   115 LSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLRHK----------ISNWFGQYMRASKDLQA 169
            :                     |.|.|.:.: .:..|:          ::.||.:..........
plant    92 M---------------------IHSGGPYGE-NIFWHRRKKTWSPEKVVTRWFEERFNYDVKTNT 134

  Fly   170 ADPSSNISSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCNFARRNMPREQVYQVGVAATGCRS 234
            ..|......:.|::...:|.:||                                   |...|.:
plant   135 CAPGKMCGHYTQMVWRETTAVGC-----------------------------------ARVKCHN 164

  Fly   235 GRNPRYPNLCALQEEYDVNAVDRFHSKRP 263
            ||.  |..:|    |||...  .:..:||
plant   165 GRG--YLVVC----EYDPRG--NYEGERP 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 25/161 (16%)
AT3G09590NP_187570.1 CAP_PR-1 50..186 CDD:349400 38/218 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.