DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and PR-1-LIKE

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_179589.1 Gene:PR-1-LIKE / 816518 AraportID:AT2G19990 Length:176 Species:Arabidopsis thaliana


Alignment Length:143 Identity:24/143 - (16%)
Similarity:43/143 - (30%) Gaps:50/143 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 ARRMASVR---WDPELAQLAEL----AAKRCSLSGDGCRNTRRFKHV------------GQLTGH 135
            ||.|..|.   |:..||..|:.    .|:.|::           ||.            |.::|.
plant    52 ARAMVGVGPMVWNETLATYAQSYAHERARDCAM-----------KHSLGPFGENLAAGWGTMSGP 105

  Fly   136 VIFSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLR-QRS 199
            |               ....|..:......|............:.|::...|..:||..:| :..
plant   106 V---------------ATEYWMTEKENYDYDSNTCGGDGVCGHYTQIVWRDSVRLGCASVRCKND 155

  Fly   200 HMLWHQQFIVCNF 212
            ..:|    ::|::
plant   156 EYIW----VICSY 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 24/143 (17%)
PR-1-LIKENP_179589.1 CAP_PR-1 42..176 CDD:349400 24/143 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.