DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and AT2G19980

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:161 Identity:36/161 - (22%)
Similarity:66/161 - (40%) Gaps:48/161 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDPELAQLAELAAKRCSL--SGDGCRNTRRFK 127
            :...||      ||:.:........|:|.|:||            ::.|::  |.||.....   
plant    37 ETLAVH------NQIRAADQKLAAHAQRYANVR------------SQDCAMKYSTDGTYGEN--- 80

  Fly   128 HVGQLTGHVIFSAGKHSDLELLRHKISN--WFGQ---YMRASKDLQAADPSSNISSFRQLIQESS 187
                      .:||....::.:...|:.  ||.:   |..|:.  :.::|..:   :.|::...|
plant    81 ----------IAAGWVQPMDTMSGPIATKFWFTEKPYYNYATN--KCSEPCGH---YTQIVANQS 130

  Fly   188 THMGCGVLR-QRSHMLWHQQFIVCNFARRNM 217
            ||:|||.:| .::..:|    :|||:|.|.|
plant   131 THLGCGTVRCFKNEYVW----VVCNYAPRPM 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 33/155 (21%)
AT2G19980NP_179588.1 SCP 35..165 CDD:294090 36/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.