DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3640 and PR1

DIOPT Version :9

Sequence 1:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_179068.1 Gene:PR1 / 815949 AraportID:AT2G14610 Length:161 Species:Arabidopsis thaliana


Alignment Length:143 Identity:30/143 - (20%)
Similarity:55/143 - (38%) Gaps:25/143 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GLSAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTG-HVIFSAGKHSDL 146
            |....||      ::||..:|..|...|::       .|...|..|.|...| ::.:.:|..|.:
plant    42 GAVGVGP------MQWDERVAAYARSYAEQ-------LRGNCRLIHSGGPYGENLAWGSGDLSGV 93

  Fly   147 ELLRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQRSHMLWHQQFIVCN 211
            .    .::.|..:  :|:.:..|...:.....:.|::...|..:||..:|..:    ....|.||
plant    94 S----AVNMWVSE--KANYNYAANTCNGVCGHYTQVVWRKSVRLGCAKVRCNN----GGTIISCN 148

  Fly   212 F-ARRNMPREQVY 223
            : .|.|...|:.|
plant   149 YDPRGNYVNEKPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 26/131 (20%)
PR1NP_179068.1 SCP_PR-1_like 30..161 CDD:240181 29/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.